| Name | Protein c-Fos | ||
| UniProt ID | FOS_HUMAN | ||
| Gene Name | FOS | ||
| Gene ID | 2353 | ||
| Synonyms |
FOS, AP-1, C-FOS, p55
|
||
| Sequence |
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.87.2.10; 1.B.1.1.1; 1.B.5.1.1; 1.B.5.1.2; 1.C.52.1.19 | ||
| KEGG ID | hsa2353 | ||
| TTD ID | T28025 | ||
| Pfam | PF00170; PF02183; PF03131; PF05300; PF07716; PF09726; PF11932 | ||
| Pair Name | Tectochrysin, Cetuximab | |||
| Phytochemical | Tectochrysin | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Protein c-Fos | Expression | |
| Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. | |||
| Pair Name | Periplocin, Gemcitabine | |||
| Phytochemical | Periplocin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Protein c-Fos | Expression | |
| Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
| 2 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |
