Name | Protein c-Fos | ||
UniProt ID | FOS_HUMAN | ||
Gene Name | FOS | ||
Gene ID | 2353 | ||
Synonyms |
FOS, AP-1, C-FOS, p55
|
||
Sequence |
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.A.87.2.10; 1.B.1.1.1; 1.B.5.1.1; 1.B.5.1.2; 1.C.52.1.19 | ||
KEGG ID | hsa2353 | ||
TTD ID | T28025 | ||
Pfam | PF00170; PF02183; PF03131; PF05300; PF07716; PF09726; PF11932 |
Pair Name | Tectochrysin, Cetuximab | |||
Phytochemical | Tectochrysin | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Protein c-Fos | Expression | |
Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. |
Pair Name | Periplocin, Gemcitabine | |||
Phytochemical | Periplocin | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Protein c-Fos | Expression | |
Result | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells |
No. | Title | Href |
---|---|---|
1 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
2 | Periplocin exerts antitumor activity by regulating Nrf2-mediated signaling pathway in gemcitabine-resistant pancreatic cancer cells. Biomed Pharmacother. 2023 Jan;157:114039. doi: 10.1016/j.biopha.2022.114039. | Click |