| Name | DNA excision repair protein ERCC-1 | ||
| UniProt ID | ERCC1_HUMAN | ||
| Gene Name | ERCC1 | ||
| Gene ID | 2067 | ||
| Synonyms |
ERCC1, COFS4, RAD10, UV20
|
||
| Sequence |
MDPGKDKEGVPQPSGPPARKKFVIPLDEDEVPPGVAKPLFRSTQSLPTVDTSAQAAPQTY
AEYAISQPLEGAGATCPTGSEPLAGETPNQALKPGAKSNSIIVSPRQRGNPVLKFVRNVP WEFGDVIPDYVLGQSTCALFLSLRYHNLHPDYIHGRLQSLGKNFALRVLLVQVDVKDPQQ ALKELAKMCILADCTLILAWSPEEAGRYLETYKAYEQKPADLLMEKLEQDFVSRVTECLT TVKSVNKTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLFDVLHEPFLKVP |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.I.1.1.3 | ||
| KEGG ID | hsa2067 | ||
| Pfam | PF00633; PF03834; PF12826; PF14520; PF20582 | ||
| Pair Name | Capsaicin, Erlotinib | |||
| Phytochemical | Capsaicin | |||
| Drug | Erlotinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | DNA excision repair protein ERCC-1 | Expression | |
| Result | These results may provide a rationale to combine capsaicin with erlotinib for lung cancer treatment. | |||
| Pair Name | Oleanolic Acid, Cisplatin | |||
| Phytochemical | Oleanolic Acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | DNA excision repair protein ERCC-1 | Expression | |
| Result | OLO-2 treatment also exhibited up to 4.6-fold selectivity against human lung adenocarcinoma cells. Taken together, the results of the present study shed light on the drug resistance-reversing effects of OLO-2 in lung cancer cells. | |||
| Pair Name | Sclareol, Cisplatin | |||
| Phytochemical | Sclareol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | DNA excision repair protein ERCC-1 | Expression | |
| Result | Sclareol has potential as an adjuvant for the treatment in NSCLC patients with cisplatin resistance. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Capsaicin enhances erlotinib-induced cytotoxicity via AKT inactivation and excision repair cross-complementary 1 (ERCC1) down-regulation in human lung cancer cells. Toxicol Res (Camb). 2019 Mar 12;8(3):459-470. doi: 10.1039/c8tx00346g. | Click |
| 2 | Olean-28,13b-olide 2 plays a role in cisplatin-mediated apoptosis and reverses cisplatin resistance in human lung cancer through multiple signaling pathways. Biochem Pharmacol. 2019;170:113642. doi:10.1016/j.bcp.2019.113642 | Click |
| 3 | Sclareol ameliorated ERCC1-mediated cisplatin resistance in A549 human lung adenocarcinoma cells and a murine xenograft tumor model by suppressing AKT-GSK3β-AP1/Snail and JNK-AP1 pathways. Chem Biol Interact. 2020 Dec 1;332:109304. doi: 10.1016/j.cbi.2020.109304. | Click |
