| Name | DNA damage-regulated autophagy modulator protein 1 | ||
| UniProt ID | DRAM1_HUMAN | ||
| Gene Name | DRAM1 | ||
| Gene ID | 55332 | ||
| Synonyms |
DRAM1, DRAM
|
||
| Sequence |
MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMI
NFSAFLGAATMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPV VHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASL ISITKLEWNPREKDYVYHVVSAICEWTVAFGFIFYFLTFIQDFQSVTLRISTEINGDI |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.113.1.8 | ||
| KEGG ID | hsa55332 | ||
| Pfam | PF09221; PF10277; PF19978 | ||
| Pair Name | Genipin, Oxaliplatin | |||
| Phytochemical | Genipin | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | DNA damage-regulated autophagy modulator protein 1 | Expression | |
| Result | We showed that genipin increases the oxaliplatin-induced cell death via p53-DRAM autophagy, we suggest that genipin is a sensitizer of oxaliplatin. | |||
| Pair Name | Luteolin, Fluorouracil | |||
| Phytochemical | Luteolin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | DNA damage-regulated autophagy modulator protein 1 | Expression | |
| Result | Current results proved the antitumor therapeutic effects of luteolin alone or combined with 5-FU as a novel strategy for cancer therapy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Genipin increases oxaliplatin-induced cell death through autophagy in gastric cancer. J Cancer. 2020 Jan 1;11(2):460-467. doi: 10.7150/jca.34773. | Click |
| 2 | Luteolin and 5-flurouracil act synergistically to induce cellular weapons in experimentally induced Solid Ehrlich Carcinoma: Realistic role of P53; a guardian fights in a cellular battle. Chem Biol Interact. 2019 Sep 1;310:108740. doi: 10.1016/j.cbi.2019.108740. | Click |
