| Name | Dickkopf-related protein 1 | ||
| UniProt ID | DKK1_HUMAN | ||
| Gene Name | DKK1 | ||
| Gene ID | 22943 | ||
| Synonyms |
DKK1, DKK-1, SK
|
||
| Sequence |
MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAV
SAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKR CMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH TKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCG EGLSCRIQKDHHQASNSSRLHTCQRH |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa22943 | ||
| TTD ID | T56697 | ||
| Pfam | PF04706; PF21479; PF21481 | ||
| Pair Name | Thymoquinone, Fluorouracil | |||
| Phytochemical | Thymoquinone | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | Dickkopf-related protein 1 | Expression | |
| Result | Our findings present the first report describing the in vivo enhancement effect of combined TQ and 5-FU against early stages of CRC; however, further studies are required to determine the value of this combination therapy in an advanced long-term model of CRC and also to realize its clinical potential. | |||
| Pair Name | Allicin, Fluorouracil | |||
| Phytochemical | Allicin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Dickkopf-related protein 1 | Expression | |
| Result | Our findings indicate that the combination of allicin with 5-FU could reverse multidrug resistance in the GC cells by reducing the expression of WNT5A, DKK1, MDR1, P-gp, and CD44 levels. | |||
| Pair Name | Andrographolide, Fluorouracil | |||
| Phytochemical | Andrographolide | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Dickkopf-related protein 1 | Expression | |
| Result | Our data provide novel evidence for andrographis-mediated reversal of 5FU resistance, highlighting its potential role as an adjunct to conventional chemotherapy in CRC. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Thymoquinone subdues tumor growth and potentiates the chemopreventive effect of 5-fluorouracil on the early stages of colorectal carcinogenesis in rats. Drug Des Devel Ther. 2016 Jul 11;10:2239-53. doi: 10.2147/DDDT.S109721. | Click |
| 2 | Allicin Reduces 5-fluorouracil-resistance in Gastric Cancer Cells through Modulating MDR1, DKK1, and WNT5A Expression. Drug Res (Stuttg). 2021 Oct;71(8):448-454. doi: 10.1055/a-1525-1499. | Click |
| 3 | Andrographis overcomes 5-fluorouracil-associated chemoresistance through inhibition of DKK1 in colorectal cancer. Carcinogenesis. 2021 Jun 21;42(6):814-825. doi: 10.1093/carcin/bgab027. | Click |
