| Name | Cathepsin D | ||
| UniProt ID | CATD_HUMAN | ||
| Gene Name | CTSD | ||
| Gene ID | 1509 | ||
| Synonyms |
CTSD, CLN10, CPSD, HEL-S-130P
|
||
| Sequence |
MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.1.2.56; 8.A.136.1.12 | ||
| KEGG ID | hsa1509 | ||
| TTD ID | T67102 | ||
| Pfam | PF00026; PF07966; PF14541; PF14543 | ||
| Pair Name | Ginsenoside Ro, Fluorouracil | |||
| Phytochemical | Ginsenoside Ro | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Down-regulation | Cathepsin D | Activity | |
| Result | Ginsenoside Ro suppresses autophagy by interfering with autophagosome-lysosome fusion and lysosomal proteolytic activity via the ESR2-NCF1-ROS axis. Subsequently, such autophagic inhibition reduces CHEK1 degradation, enhances CHEK1-mediated DNA damage checkpoint arrest, and thereby sensitizes tumor cells to 5-Fu-induced cell death. | |||
| Pair Name | Toosendanin, Camptothecin | |||
| Phytochemical | Toosendanin | |||
| Drug | Camptothecin | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Cathepsin D | Expression | |
| Result | These results suggest that toosendanin has the potential to be developed into an anti-cancer drug by blocking chemotherapy-induced protective autophagy. | |||
| Pair Name | Toosendanin, Irinotecan | |||
| Phytochemical | Toosendanin | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Cathepsin D | Expression | |
| Result | The data showed that TSN blocked 7-ethyl-10-hydroxycamptothecin (SN-38)/irinotecan-induced protective autophagy, and significantly induced apoptosis in TNBC cells and tumor xenograft models when compared to SN-38/irinotecan alone group. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Inhibition of autophagosome-lysosome fusion by ginsenoside Ro via the ESR2-NCF1-ROS pathway sensitizes esophageal cancer cells to 5-fluorouracil-induced cell death via the CHEK1-mediated DNA damage checkpoint. Autophagy. 2016;12(9):1593-1613. doi:10.1080/15548627.2016.1192751 | Click |
| 2 | Toosendanin, a novel potent vacuolar-type H+-translocating ATPase inhibitor, sensitizes cancer cells to chemotherapy by blocking protective autophagy. Int J Biol Sci. 2022 Mar 28;18(7):2684-2702. doi: 10.7150/ijbs.71041. | Click |
| 3 | Toosendanin, a late-stage autophagy inhibitor, sensitizes triple-negative breast cancer to irinotecan chemotherapy. Chin Med. 2022 May 6;17(1):55. doi: 10.1186/s13020-022-00605-8. | Click |
