| Name | Tumor necrosis factor receptor superfamily member 5 | ||
| UniProt ID | TNR5_HUMAN | ||
| Gene Name | CD40 | ||
| Gene ID | 958 | ||
| Synonyms |
CD40, Bp50, CDW40, TNFRSF5, p50
|
||
| Sequence |
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECL
PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV LHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTN KTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPD DLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.177.1.5; 8.A.77.1.3 | ||
| KEGG ID | hsa958 | ||
| TTD ID | T45758 | ||
| Pfam | PF00020; PF01034; PF18278 | ||
| Pair Name | Beta-Elemene, Fluorouracil | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor receptor superfamily member 5 | Expression | |
| Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. | |||
| Pair Name | Tectochrysin, Cetuximab | |||
| Phytochemical | Tectochrysin | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Tumor necrosis factor receptor superfamily member 5 | Expression | |
| Result | Our results indicate that combined therapy with lower concentration of cetuximab and tectochrysin could significantly enhance the cancer cell growth inhibitory effect through the inhibition of EGFR signaling. | |||
| No. | Title | Href |
|---|---|---|
| 1 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
| 2 | Synergistic inhibitory effect of cetuximab and tectochrysin on human colon cancer cell growth via inhibition of EGFR signal. Arch Pharm Res. 2016 May;39(5):721-9. doi: 10.1007/s12272-016-0735-7. | Click |
