| Name | Inactive caspase-12 | ||
| UniProt ID | CASPC_HUMAN | ||
| Gene Name | CASP12 | ||
| Gene ID | 100506742 | ||
| Synonyms |
CASP12, CASP-12, CASP12P1
|
||
| Sequence |
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELD LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICG TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASAD THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS HHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa100506742 | ||
| Pfam | PF00619; PF00656 | ||
| Pair Name | Mangiferin, Cisplatin | |||
| Phytochemical Name | Mangiferin | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | Nephrotoxicity | Investigative | ||
| Regulate Info | Down-regulation | Inactive caspase-12 | Cleavage | |
| Result | The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin. | |||
| Pair Name | Resveratrol, Cisplatin | |||
| Phytochemical | Resveratrol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Up-regulation | Inactive caspase-12 | Cleavage | |
| Result | These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy. | |||
| Pair Name | Sulforaphene, Photodynamic therapy | |||
| Phytochemical | Sulforaphene | |||
| Drug | Photodynamic therapy | |||
| Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
| Regulate Info | Up-regulation | Inactive caspase-12 | Expression | |
| Result | This study could be useful in the improvement of therapies for human cervical and other types of cancers. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. | Click |
| 2 | Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. | Click |
| 3 | Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. | Click |
