Name | Inactive caspase-12 | ||
UniProt ID | CASPC_HUMAN | ||
Gene Name | CASP12 | ||
Gene ID | 100506742 | ||
Synonyms |
CASP12, CASP-12, CASP12P1
|
||
Sequence |
MADEKPSNGVLVHMVKLLIKTFLDGIFDDLMENNVLNTDEIHLIGKCLKFVVSNAENLVD
DITETAQIAGKIFREHLWNSKKQLSSDISSDGEREANMPGLNIRNKEFNYLHNRNGSELD LLGMRDLLENLGYSVVIKENLTAQEMETALRQFAAHPEHQSSDSTFLVFMSHSILNGICG TKHWDQEPDVLHDDTIFEIFNNRNCQSLKDKPKVIIMQACRGNGAGIVWFTTDSGKASAD THGRLLQGNICNDAVTKAHVEKDFIAFKSSTPHNVSWRHETNGSVFISQIIYYFREYSWS HHLEEIFQKVQHSFETPNILTQLPTIERLSMTRYFYLFPGN |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa100506742 | ||
Pfam | PF00619; PF00656 |
Pair Name | Mangiferin, Cisplatin | |||
Phytochemical Name | Mangiferin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | Nephrotoxicity | Investigative | ||
Regulate Info | Down-regulation | Inactive caspase-12 | Cleavage | |
Result | The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin. |
Pair Name | Resveratrol, Cisplatin | |||
Phytochemical | Resveratrol | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Up-regulation | Inactive caspase-12 | Cleavage | |
Result | These results indicated that RES is a promising adjuvant for DDP during GC chemotherapy. |
Pair Name | Sulforaphene, Photodynamic therapy | |||
Phytochemical | Sulforaphene | |||
Drug | Photodynamic therapy | |||
Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
Regulate Info | Up-regulation | Inactive caspase-12 | Expression | |
Result | This study could be useful in the improvement of therapies for human cervical and other types of cancers. |
No. | Title | Href |
---|---|---|
1 | Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. | Click |
2 | Resveratrol synergizes with cisplatin in antineoplastic effects against AGS gastric cancer cells by inducing endoplasmic reticulum stress‑mediated apoptosis and G2/M phase arrest. Oncol Rep. 2020 Oct;44(4):1605-1615. doi: 10.3892/or.2020.7708. | Click |
3 | Evaluation of synergistic effects of sulforaphene with photodynamic therapy in human cervical cancer cell line. Lasers Med Sci. 2016 Nov;31(8):1675-1682. doi: 10.1007/s10103-016-2037-1. | Click |