
| Name | Proline-rich AKT1 substrate 1 | ||
| UniProt ID | AKTS1_HUMAN | ||
| Gene Name | AKT1S1 | ||
| Gene ID | 84335 | ||
| Synonyms |
AKT1S1, Lobe, PRAS40
|
||
| Sequence |
MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP RPRLNTSDFQKLKRKY |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa84335 | ||
| TTD ID | T58772 | ||
| Pfam | PF04520; PF15798 | ||
| Pair Name | Fisetin, Fluorouracil | |||
| Phytochemical | Fisetin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Proline-rich AKT1 substrate 1 | Phosphorylation | |
| Result | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer | |||
| Pair Name | Cucurbitacin B, Cisplatin | |||
| Phytochemical | Cucurbitacin B | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C94.Z] | Bladder cancer | Investigative | |
| Regulate Info | Down-regulation | Proline-rich AKT1 substrate 1 | Phosphorylation | |
| Result | Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer. | |||
| Pair Name | Sulforaphane, PP242 | |||
| Phytochemical | Sulforaphane | |||
| Drug | PP242 | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Down-regulation | Proline-rich AKT1 substrate 1 | Phosphorylation | |
| Result | Our findings demonstrate that PP242 enhances the anti-tumor activity of SFN by blocking SFN-induced activation of Akt/mTOR pathway in ESCC, which provides a rationale for treating ESCC using SFN combined with Akt/mTOR pathway inhibitors. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. | Click |
| 2 | Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. | Click |
| 3 | mTOR inhibitor PP242 increases antitumor activity of sulforaphane by blocking Akt/mTOR pathway in esophageal squamous cell carcinoma. Mol Biol Rep. 2022 Jan;49(1):451-461. doi: 10.1007/s11033-021-06895-9. | Click |