TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Proline-rich AKT1 substrate 1
UniProt ID AKTS1_HUMAN
Gene Name AKT1S1
Gene ID 84335
Synonyms
AKT1S1, Lobe, PRAS40
Sequence
MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY
Pathway Map MAP LINK
KEGG ID hsa84335
TTD ID T58772
Pfam PF04520; PF15798
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 73
Pair Name Fisetin, Fluorouracil
Phytochemical Fisetin
Drug Fluorouracil
Disease Info [ICD-11: 2B91.Z] Colorectal cancer Investigative
Regulate Info Down-regulation Proline-rich AKT1 substrate 1 Phosphorylation
Result Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer
Combination Pair ID: 217
Pair Name Cucurbitacin B, Cisplatin
Phytochemical Cucurbitacin B
Drug Cisplatin
Disease Info [ICD-11: 2C94.Z] Bladder cancer Investigative
Regulate Info Down-regulation Proline-rich AKT1 substrate 1 Phosphorylation
Result Our results showed that CuB may be a new agent that can support conventional treatment in bladder cancer. Our study is important in terms of enlightening new pathways and developing new treatment methods in the treatment of bladder cancer.
Combination Pair ID: 551
Pair Name Sulforaphane, PP242
Phytochemical Sulforaphane
Drug PP242
Disease Info [ICD-11: 2B70] Esophageal cancer Investigative
Regulate Info Down-regulation Proline-rich AKT1 substrate 1 Phosphorylation
Result Our findings demonstrate that PP242 enhances the anti-tumor activity of SFN by blocking SFN-induced activation of Akt/mTOR pathway in ESCC, which provides a rationale for treating ESCC using SFN combined with Akt/mTOR pathway inhibitors.
03. Reference
No. Title Href
1 Fisetin and 5-fluorouracil: Effective combination for PIK3CA-mutant colorectal cancer. Int J Cancer. 2019 Dec 1;145(11):3022-3032. doi: 10.1002/ijc.32367. Click
2 Cucurbitacin B and cisplatin induce the cell death pathways in MB49 mouse bladder cancer model. Exp Biol Med (Maywood). 2020 May;245(9):805-814. doi: 10.1177/1535370220917367. Click
3 mTOR inhibitor PP242 increases antitumor activity of sulforaphane by blocking Akt/mTOR pathway in esophageal squamous cell carcinoma. Mol Biol Rep. 2022 Jan;49(1):451-461. doi: 10.1007/s11033-021-06895-9. Click
It has been 508491 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP