| Name | Protein Wnt-5a | ||
| UniProt ID | WNT5A_HUMAN | ||
| Gene Name | WNT5A | ||
| Gene ID | 7474 | ||
| Synonyms |
WNT5A, hWNT5A
|
||
| Sequence |
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCK |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 9.B.200.1.1 | ||
| KEGG ID | hsa7474 | ||
| TTD ID | T13175 | ||
| Pfam | PF00110 | ||
| Pair Name | Tetrandrine, Cisplatin | |||
| Phytochemical | Tetrandrine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Protein Wnt-5a | Expression | |
| Result | Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo | |||
| Pair Name | Allicin, Fluorouracil | |||
| Phytochemical | Allicin | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
| Regulate Info | Down-regulation | Protein Wnt-5a | Expression | |
| Result | Our findings indicate that the combination of allicin with 5-FU could reverse multidrug resistance in the GC cells by reducing the expression of WNT5A, DKK1, MDR1, P-gp, and CD44 levels. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. | Click |
| 2 | Allicin Reduces 5-fluorouracil-resistance in Gastric Cancer Cells through Modulating MDR1, DKK1, and WNT5A Expression. Drug Res (Stuttg). 2021 Oct;71(8):448-454. doi: 10.1055/a-1525-1499. | Click |
