Name | Protein Wnt-5a | ||
UniProt ID | WNT5A_HUMAN | ||
Gene Name | WNT5A | ||
Gene ID | 7474 | ||
Synonyms |
WNT5A, hWNT5A
|
||
Sequence |
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH WCCYVKCKKCTEIVDQFVCK |
||
Pathway Map | MAP LINK | ||
T.C. Number | 9.B.200.1.1 | ||
KEGG ID | hsa7474 | ||
TTD ID | T13175 | ||
Pfam | PF00110 |
Pair Name | Tetrandrine, Cisplatin | |||
Phytochemical | Tetrandrine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Protein Wnt-5a | Expression | |
Result | Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo |
Pair Name | Allicin, Fluorouracil | |||
Phytochemical | Allicin | |||
Drug | Fluorouracil | |||
Disease Info | [ICD-11: 2B72.Z] | Gastric cancer | Investigative | |
Regulate Info | Down-regulation | Protein Wnt-5a | Expression | |
Result | Our findings indicate that the combination of allicin with 5-FU could reverse multidrug resistance in the GC cells by reducing the expression of WNT5A, DKK1, MDR1, P-gp, and CD44 levels. |
No. | Title | Href |
---|---|---|
1 | Combination of Tetrandrine with cisplatin enhances cytotoxicity through growth suppression and apoptosis in ovarian cancer in vitro and in vivo. Cancer Lett. 2011 May 1;304(1):21-32. doi: 10.1016/j.canlet.2011.01.022. | Click |
2 | Allicin Reduces 5-fluorouracil-resistance in Gastric Cancer Cells through Modulating MDR1, DKK1, and WNT5A Expression. Drug Res (Stuttg). 2021 Oct;71(8):448-454. doi: 10.1055/a-1525-1499. | Click |