| Name | Metalloproteinase inhibitor 2 | ||
| UniProt ID | TIMP2_HUMAN | ||
| Gene Name | TIMP2 | ||
| Gene ID | 7077 | ||
| Synonyms |
TIMP2, CSC-21K, DDC8
|
||
| Sequence |
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa7077 | ||
| Pfam | PF00965; PF01759 | ||
| Pair Name | Alpha-Carotene, Paclitaxel | |||
| Phytochemical | Alpha-Carotene | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 2 | Expression | |
| Result | We demonstrate that AC effectively inhibits LLC metastasis and suppresses lung metastasis in combination with taxol in LLC-bearing mice, suggesting that AC could be used as an anti-metastatic agent or as an adjuvant for anti-cancer drugs. | |||
| Pair Name | Beta-Ionone, Sorafenib | |||
| Phytochemical | Beta-Ionone | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 2 | Expression | |
| Result | SF enhanced the suppressing effect of BI (1-50 μM) on the viability of SK-Hep-1 cells, but not on murine hepatic BNL CL.2 cells, indicating the selective cytotoxicity of this combination on tumor cells. The combination of SF and BI could be a potential therapeutic strategy against human hepatoma cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Alpha-carotene inhibits metastasis in Lewis lung carcinoma in vitro, and suppresses lung metastasis and tumor growth in combination with taxol in tumor xenografted C57BL/6 mice. J Nutr Biochem. 2015 Jun;26(6):607-15. doi: 10.1016/j.jnutbio.2014.12.012. | Click |
| 2 | Synergistic effects of the combination of β-ionone and sorafenib on metastasis of human hepatoma SK-Hep-1 cells. Invest New Drugs. 2012;30(4):1449-1459. doi:10.1007/s10637-011-9727-0 | Click |
