| Name | Metalloproteinase inhibitor 1 | ||
| UniProt ID | TIMP1_HUMAN | ||
| Gene Name | TIMP1 | ||
| Gene ID | 7076 | ||
| Synonyms |
TIMP1, CLGI, EPA, EPO, HCI, TIMP, TIMP-1
|
||
| Sequence |
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK GFQSRHLACLPREPGLCTWQSLRSQIA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa7076 | ||
| Pfam | PF00965 | ||
| Pair Name | Kuromanin chloride, Cisplatin | |||
| Phytochemical Name | Kuromanin chloride | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 1 | Activity | |
| Result | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells | |||
| Pair Name | Alpha-Carotene, Paclitaxel | |||
| Phytochemical | Alpha-Carotene | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 1 | Expression | |
| Result | We demonstrate that AC effectively inhibits LLC metastasis and suppresses lung metastasis in combination with taxol in LLC-bearing mice, suggesting that AC could be used as an anti-metastatic agent or as an adjuvant for anti-cancer drugs. | |||
| Pair Name | Beta-Ionone, Sorafenib | |||
| Phytochemical | Beta-Ionone | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 1 | Expression | |
| Result | SF enhanced the suppressing effect of BI (1-50 μM) on the viability of SK-Hep-1 cells, but not on murine hepatic BNL CL.2 cells, indicating the selective cytotoxicity of this combination on tumor cells. The combination of SF and BI could be a potential therapeutic strategy against human hepatoma cells. | |||
| Pair Name | Epigallocatechin gallate, TNF-related apoptosis inducing ligand | |||
| Phytochemical | Epigallocatechin gallate | |||
| Drug | TNF-related apoptosis inducing ligand | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Up-regulation | Metalloproteinase inhibitor 1 | Expression | |
| Result | EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis | |||
| Pair Name | Garcinol, Paclitaxel | |||
| Phytochemical | Garcinol | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Metalloproteinase inhibitor 1 | Expression | |
| Result | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model | |||
| No. | Title | Href |
|---|---|---|
| 1 | Cyanidin-3-O-glucoside and cisplatin inhibit proliferation and downregulate the PI3K/AKT/mTOR pathway in cervical cancer cells. J Food Sci. 2021 Jun;86(6):2700-2712. doi: 10.1111/1750-3841.15740. | Click |
| 2 | Alpha-carotene inhibits metastasis in Lewis lung carcinoma in vitro, and suppresses lung metastasis and tumor growth in combination with taxol in tumor xenografted C57BL/6 mice. J Nutr Biochem. 2015 Jun;26(6):607-15. doi: 10.1016/j.jnutbio.2014.12.012. | Click |
| 3 | Synergistic effects of the combination of β-ionone and sorafenib on metastasis of human hepatoma SK-Hep-1 cells. Invest New Drugs. 2012;30(4):1449-1459. doi:10.1007/s10637-011-9727-0 | Click |
| 4 | Green tea polyphenol EGCG sensitizes human prostate carcinoma LNCaP cells to TRAIL-mediated apoptosis and synergistically inhibits biomarkers associated with angiogenesis and metastasis. Oncogene. 2008 Mar 27;27(14):2055-63. doi: 10.1038/sj.onc.1210840. | Click |
| 5 | Garcinol sensitizes breast cancer cells to Taxol through the suppression of caspase-3/iPLA2 and NF-κB/Twist1 signaling pathways in a mouse 4T1 breast tumor model. Food Funct. 2017 Mar 22;8(3):1067-1079. doi: 10.1039/c6fo01588c. | Click |
