| Name | S-phase kinase-associated protein 2 | ||
| UniProt ID | SKP2_HUMAN | ||
| Gene Name | SKP2 | ||
| Gene ID | 6502 | ||
| Synonyms |
SKP2, FBL1, FBXL1, FLB1, p45
|
||
| Sequence |
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK PSCL |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa6502 | ||
| TTD ID | T80306 | ||
| Pfam | PF00646; PF12937; PF13855; PF18511; PF19729 | ||
| Pair Name | Flavokawain A, Herceptin | |||
| Phytochemical | Flavokawain A | |||
| Drug | Herceptin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | S-phase kinase-associated protein 2 | Expression | |
| Result | Our results suggest FKA as a promising and novel apoptosis inducer and G2 blocking agent that, in combination with Herceptin, enhances for the treatment of HER2-overexpressing breast cancer. | |||
| Pair Name | Flavokawain B, Bortezomib | |||
| Phytochemical | Flavokawain B | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | S-phase kinase-associated protein 2 | Expression | |
| Result | These findings provide a rationale for further investigating combination of FKB and Bortezomib for treatment of RB deficient, castration-resistant prostate cancer. | |||
| Pair Name | Nobiletin, Palbociclib | |||
| Phytochemical | Nobiletin | |||
| Drug | Palbociclib | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | S-phase kinase-associated protein 2 | Expression | |
| Result | Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma | |||
| No. | Title | Href |
|---|---|---|
| 1 | Induction of G2M Arrest by Flavokawain A, a Kava Chalcone, Increases the Responsiveness of HER2-Overexpressing Breast Cancer Cells to Herceptin. Molecules. 2017 Mar 14;22(3):462. doi: 10.3390/molecules22030462. | Click |
| 2 | Flavokawain B targets protein neddylation for enhancing the anti-prostate cancer effect of Bortezomib via Skp2 degradation. Cell Commun Signal. 2019 Mar 18;17(1):25. doi: 10.1186/s12964-019-0338-2. | Click |
| 3 | Nobiletin downregulates the SKP2-p21/p27-CDK2 axis to inhibit tumor progression and shows synergistic effects with palbociclib on renal cell carcinoma. Cancer Biol Med. 2021 Feb 15;18(1):227-244. doi: 10.20892/j.issn.2095-3941.2020.0186. | Click |
