Name | Sonic hedgehog protein | ||
UniProt ID | SHH_HUMAN | ||
Gene Name | SHH | ||
Gene ID | 6469 | ||
Synonyms |
SHH, HHG1, HLP3, HPE3, MCOPCB5, SMMCI, ShhNC, TPT, TPTPS
|
||
Sequence |
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.6.6.13; 2.A.6.6.14; 9.A.14.1.11 | ||
KEGG ID | hsa6469 | ||
TTD ID | T12075 | ||
Pfam | PF01079; PF01085; PF01092; PF08291 |
Pair Name | Beta-Elemene, Gefitinib | |||
Phytochemical | Beta-Elemene | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Sonic hedgehog protein | Expression | |
Result | The findings may have potential implications for treating aggressive and resistant lung cancers. |
Pair Name | Gambogic Acid, Paclitaxel | |||
Phytochemical | Gambogic Acid | |||
Drug | Paclitaxel | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Sonic hedgehog protein | Expression | |
Result | The combination of GA with paclitaxel may increase the antitumor effects on paclitaxel‑resistant TNBC via downregulating the SHH signaling pathway. |
Pair Name | Solamargine, Cisplatin | |||
Phytochemical | Solamargine | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Sonic hedgehog protein | Expression | |
Result | Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids |
Pair Name | Ginsenoside Rb1, Cisplatin | |||
Phytochemical | Ginsenoside Rb1 | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Sonic hedgehog protein | Expression | |
Result | Ginsenoside Rb1 for overcoming cisplatin-insensitivity of A549/DDP cells in vitro and vivo through the dual-inhibition on two efflux pumps of ABCB1 and PTCH1 |
Pair Name | Sulforaphane, Gefitinib | |||
Phytochemical | Sulforaphane | |||
Drug | Gefitinib | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Sonic hedgehog protein | Expression | |
Result | The results of the present study demonstrated that SFN inhibits the proliferation of gefitinib-tolerant lung cancer cells via modulation of the SHH signaling pathway. Therefore, combined SFN and gefitinib therapy may be an effective approach for the treatment of lung cancer. |
No. | Title | Href |
---|---|---|
1 | β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. | Click |
2 | Gambogic acid increases the sensitivity to paclitaxel in drug‑resistant triple‑negative breast cancer via the SHH signaling pathway. Mol Med Rep. 2019 Nov;20(5):4515-4522. doi: 10.3892/mmr.2019.10697. | Click |
3 | Identification of solamargine as a cisplatin sensitizer through phenotypical screening in cisplatin-resistant NSCLC organoids. Front Pharmacol. 2022 Aug 10;13:802168. doi: 10.3389/fphar.2022.802168. | Click |
4 | Ginsenoside Rb1 for overcoming cisplatin-insensitivity of A549/DDP cells in vitro and vivo through the dual-inhibition on two efflux pumps of ABCB1 and PTCH1. Phytomedicine. 2023 Jul;115:154776. doi: 10.1016/j.phymed.2023.154776. | Click |
5 | Sulforaphane reverses gefitinib tolerance in human lung cancer cells via modulation of sonic hedgehog signaling. Oncol Lett. 2018 Jan;15(1):109-114. doi: 10.3892/ol.2017.7293. | Click |