| Name | GTP-binding protein Rheb | ||
| UniProt ID | RHEB_HUMAN | ||
| Gene Name | RHEB | ||
| Gene ID | 6009 | ||
| Synonyms |
RHEB, RHEB2
|
||
| Sequence |
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKMDGAASQGKSS CSVM |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.18.9.1 | ||
| KEGG ID | hsa6009 | ||
| Pfam | PF00009; PF00025; PF00071; PF01926; PF03193; PF08477; PF09439; PF13173; PF19518 | ||
| Pair Name | Brusatol, Cabergoline | |||
| Phytochemical | Brusatol | |||
| Drug | Cabergoline | |||
| Disease Info | [ICD-11: 2F37] | Pituitary adenomas | Investigative | |
| Regulate Info | Down-regulation | GTP-binding protein Rheb | Expression | |
| Result | Combined use of CAB and BT may increase the clinical effectiveness of treatment for human pituitary adenomas. | |||
| Pair Name | Menadione, Ascorbic Acid | |||
| Phytochemical | Menadione | |||
| Drug | Ascorbic Acid | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | GTP-binding protein Rheb | Expression | |
| Result | These results suggest that AA+MD or MD treatment in combination with autophagy inducers could be further investigated as a novel approach for glioblastoma therapy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Brusatol Inhibits Tumor Growth and Increases the Efficacy of Cabergoline against Pituitary Adenomas. Oxid Med Cell Longev. 2021 Jun 16;2021:6696015. doi: 10.1155/2021/6696015. | Click |
| 2 | Combination of Ascorbic Acid and Menadione Induces Cytotoxic Autophagy in Human Glioblastoma Cells. Oxid Med Cell Longev. 2022 Mar 23;2022:2998132. doi: 10.1155/2022/2998132. | Click |
