| Name | Ras-related C3 botulinum toxin substrate 1 | ||
| UniProt ID | RAC1_HUMAN | ||
| Gene Name | RAC1 | ||
| Gene ID | 5879 | ||
| Synonyms |
RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1
|
||
| Sequence |
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP PVKKRKRKCLLL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.F.3.1.4; 8.A.25.1.5; 9.A.14.13.35; 9.A.14.6.7 | ||
| KEGG ID | hsa5879 | ||
| TTD ID | T88752 | ||
| Pfam | PF00009; PF00025; PF00071; PF08477; PF16567 | ||
| Pair Name | Beta-Ionone, Sorafenib | |||
| Phytochemical | Beta-Ionone | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ras-related C3 botulinum toxin substrate 1 | Expression | |
| Result | SF enhanced the suppressing effect of BI (1-50 μM) on the viability of SK-Hep-1 cells, but not on murine hepatic BNL CL.2 cells, indicating the selective cytotoxicity of this combination on tumor cells. The combination of SF and BI could be a potential therapeutic strategy against human hepatoma cells. | |||
| Pair Name | Hesperetin, Doxorubicin | |||
| Phytochemical | Hesperetin | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | Ras-related C3 botulinum toxin substrate 1 | Expression | |
| Result | These results indicated that the combination of Hst and Dox-induced cell cycle arrest, apoptosis, decreased HER2, Rac1, MMP9 expression, and cell migration. Thus, Hst may have the potential to be developed as a co-chemotherapeutic agent combined with doxorubicin toward HER2 overexpressing breast cancer cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic effects of the combination of β-ionone and sorafenib on metastasis of human hepatoma SK-Hep-1 cells. Invest New Drugs. 2012;30(4):1449-1459. doi:10.1007/s10637-011-9727-0 | Click |
| 2 | Cytotoxic and Antimetastatic Activity of Hesperetin and Doxorubicin Combination Toward Her2 Expressing Breast Cancer Cells. Asian Pac J Cancer Prev. 2020 May 1;21(5):1259-1267. doi: 10.31557/APJCP.2020.21.5.1259. | Click |
