TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Ras-related C3 botulinum toxin substrate 1
UniProt ID RAC1_HUMAN
Gene Name RAC1
Gene ID 5879
Synonyms
RAC1, MIG5, MRD48, Rac-1, TC-25, p21-Rac1
Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
Pathway Map MAP LINK
T.C. Number 1.F.3.1.4; 8.A.25.1.5; 9.A.14.13.35; 9.A.14.6.7
KEGG ID hsa5879
TTD ID T88752
Pfam PF00009; PF00025; PF00071; PF08477; PF16567
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 87
Pair Name Hesperetin, Doxorubicin
Phytochemical Hesperetin
Drug Doxorubicin
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Down-regulation Ras-related C3 botulinum toxin substrate 1 Expression
Result These results indicated that the combination of Hst and Dox-induced cell cycle arrest, apoptosis, decreased HER2, Rac1, MMP9 expression, and cell migration. Thus, Hst may have the potential to be developed as a co-chemotherapeutic agent combined with doxorubicin toward HER2 overexpressing breast cancer cells.
Combination Pair ID: 529
Pair Name Beta-Ionone, Sorafenib
Phytochemical Beta-Ionone
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Ras-related C3 botulinum toxin substrate 1 Expression
Result SF enhanced the suppressing effect of BI (1-50 μM) on the viability of SK-Hep-1 cells, but not on murine hepatic BNL CL.2 cells, indicating the selective cytotoxicity of this combination on tumor cells. The combination of SF and BI could be a potential therapeutic strategy against human hepatoma cells.
03. Reference
No. Title Href
1 Cytotoxic and Antimetastatic Activity of Hesperetin and Doxorubicin Combination Toward Her2 Expressing Breast Cancer Cells. Asian Pac J Cancer Prev. 2020 May 1;21(5):1259-1267. doi: 10.31557/APJCP.2020.21.5.1259. Click
2 Synergistic effects of the combination of β-ionone and sorafenib on metastasis of human hepatoma SK-Hep-1 cells. Invest New Drugs. 2012;30(4):1449-1459. doi:10.1007/s10637-011-9727-0 Click
It has been 508412 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP