Name | Programmed cell death protein 4 | ||
UniProt ID | PDCD4_HUMAN | ||
Gene Name | PDCD4 | ||
Gene ID | 27250 | ||
Synonyms |
PDCD4, H731
|
||
Sequence |
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa27250 | ||
Pfam | PF02847; PF04774; PF09085 |
Pair Name | Bufalin, Hydroxycamptothecin | |||
Phytochemical | Bufalin | |||
Drug | Hydroxycamptothecin | |||
Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
Regulate Info | Up-regulation | Programmed cell death protein 4 | Expression | |
Result | The present study suggested that the combination of bufalin and hydroxycampothecin improved the inhibitory effects of both drugs on CRPC tumors in vivo, potentially via the regulation of the PI3K/AKT/GSK-3β and p53-dependent apoptosis signaling pathways. |
Pair Name | Cordycepin, Temozolomide | |||
Phytochemical | Cordycepin | |||
Drug | Temozolomide | |||
Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
Regulate Info | Up-regulation | Programmed cell death protein 4 | Expression | |
Result | Cordycepin combined with temozolomide may down-regulate MYC through "MicroRNA in cancer, Proteoglycans in cancer, Pathways in cancer and PI3K-AKT signaling pathway", which in turn regulate the expression of MCL1, CTNNB1, MMP9, PDCD4, thus regulating cell proliferation, migration and apoptosis in glioblastoma. |
No. | Title | Href |
---|---|---|
1 | Effects of low-dose bufalin combined with hydroxycamptothecin on human castration-resistant prostate cancer xenografts in nude mice. Exp Ther Med. 2021 Sep;22(3):1015. doi: 10.3892/etm.2021.10447. | Click |
2 | Cordycepin improves sensitivity to temozolomide in glioblastoma cells by down-regulating MYC. J Cancer Res Clin Oncol. 2023 Nov;149(17):16055-16067. doi: 10.1007/s00432-023-05347-0. | Click |