| Name | NANOG neighbor homeobox | ||
| UniProt ID | NANGN_HUMAN | ||
| Gene Name | NANOGNB | ||
| Gene ID | 360030 | ||
| Synonyms |
NANOGNB
|
||
| Sequence |
MHRARWLTPVIPALWEAEAGRSRGQEIETILANKKQSAMPWDQDPEQSTGNYSEDEQNGK
QKWREEGEAGRKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSKSLMHTLWAK FKLNRCPTIQESLSLSFEFDMTHKQISQWFCKTRKKYNKEMSKRKHKKKHMRWRSLCCQG WSRTPALK |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa360030 | ||
| Pfam | PF00046; PF02724; PF05920; PF17943 | ||
| Pair Name | Sulforaphane, Acetazolamide | |||
| Phytochemical | Sulforaphane | |||
| Drug | Acetazolamide | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | NANOG neighbor homeobox | Expression | |
| Result | Human bronchial carcinoid tumor cells serially passaged as spheroids contain a higher fraction of TIC exhibiting a stemness phenotype. This TIC population can be effectively targeted by the combination of AZ + SFN. Our work portends clinical relevance and supports the therapeutic use of the novel AZ+ SFN combination that may target the TIC population of bronchial carcinoids. | |||
