
| Name | Diphosphomevalonate decarboxylase | ||
| UniProt ID | MVD1_HUMAN | ||
| Gene Name | MVD | ||
| Gene ID | 4597 | ||
| Synonyms |
MVD, FP17780, MDDase, MPD, POROK7
|
||
| Sequence |
MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDF
TEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPT AAGLASSAAGYACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEM ARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKV AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAM EPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4597 | ||
| TTD ID | T96862 | ||
| Pfam | PF00288; PF18376 | ||
| Pair Name | Ilexgenin A, Sorafenib | |||
| Phytochemical Name | Ilexgenin A | |||
| Anticancer drug Name | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Diphosphomevalonate decarboxylase | Expression | |
| Result | The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth. | |||
| Pair Name | Tetrahydrocurcumin, Celecoxib | |||
| Phytochemical | Tetrahydrocurcumin | |||
| Drug | Celecoxib | |||
| Disease Info | [ICD-11: 2C77.Z] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Diphosphomevalonate decarboxylase | Expression | |
| Result | The combinational treatment effect of THC and celecoxib causing inhibition of tumor growth and tumor angiogenesis via down-regulation of VEGF, COX-2 and EGFR expression. However, this combined treatment did not show the synergistic effect on inhibiting the tumor growth and tumor angiogenesis in cervical cancer (CaSki)-implanted nude mice model. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. | Click |
| 2 | Combinational Treatment Effect of Tetrahydrocurcumin and Celecoxib on Cervical Cancer Cell-Induced Tumor Growth and Tumor Angiogenesis in Nude Mice. J Med Assoc Thai. 2016 Jul;99 Suppl 4:S23-31. | Click |