Name | Diphosphomevalonate decarboxylase | ||
UniProt ID | MVD1_HUMAN | ||
Gene Name | MVD | ||
Gene ID | 4597 | ||
Synonyms |
MVD, FP17780, MDDase, MPD, POROK7
|
||
Sequence |
MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDF
TEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPT AAGLASSAAGYACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEM ARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKV AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAM EPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa4597 | ||
TTD ID | T96862 | ||
Pfam | PF00288; PF18376 |
Pair Name | Ilexgenin A, Sorafenib | |||
Phytochemical Name | Ilexgenin A | |||
Anticancer drug Name | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Diphosphomevalonate decarboxylase | Expression | |
Result | The results described in the present study identifies Ilexgenin A as a promising therapeutic candidate that modulates inflammation, angiogenesis, and HCC growth. |
Pair Name | Tetrahydrocurcumin, Celecoxib | |||
Phytochemical | Tetrahydrocurcumin | |||
Drug | Celecoxib | |||
Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
Regulate Info | Down-regulation | Diphosphomevalonate decarboxylase | Expression | |
Result | The combinational treatment effect of THC and celecoxib causing inhibition of tumor growth and tumor angiogenesis via down-regulation of VEGF, COX-2 and EGFR expression. However, this combined treatment did not show the synergistic effect on inhibiting the tumor growth and tumor angiogenesis in cervical cancer (CaSki)-implanted nude mice model. |
No. | Title | Href |
---|---|---|
1 | Ilexgenin A exerts anti-inflammation and anti-angiogenesis effects through inhibition of STAT3 and PI3K pathways and exhibits synergistic effects with Sorafenib on hepatoma growth. Toxicol Appl Pharmacol. 2017 Jan 15;315:90-101. doi: 10.1016/j.taap.2016.12.008. | Click |
2 | Combinational Treatment Effect of Tetrahydrocurcumin and Celecoxib on Cervical Cancer Cell-Induced Tumor Growth and Tumor Angiogenesis in Nude Mice. J Med Assoc Thai. 2016 Jul;99 Suppl 4:S23-31. | Click |