| Name | Matrix metalloproteinase-1 | ||
| UniProt ID | MMP1_HUMAN | ||
| Gene Name | MMP1 | ||
| Gene ID | 4312 | ||
| Synonyms |
MMP1, CLG, CLGN
|
||
| Sequence |
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.3.10.16; 8.A.21.3.1; 8.B.14.2.3 | ||
| KEGG ID | hsa4312 | ||
| TTD ID | T52450 | ||
| Pfam | PF00045; PF00413; PF01471; PF03032; PF07998; PF10462; PF12044; PF13582; PF13583; PF13688; PF16313 | ||
| Pair Name | Brassinolid, Doxorubicin | |||
| Phytochemical | Brassinolid | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Down-regulation | Matrix metalloproteinase-1 | Expression | |
| Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. | |||
| Pair Name | Sulforaphane, Fernblock® XP | |||
| Phytochemical | Sulforaphane | |||
| Drug | Fernblock® XP | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Down-regulation | Matrix metalloproteinase-1 | Expression | |
| Result | SFN/FB was more efficient than SFN or FB alone in inhibiting MMP-1 and -3 production and IL-1β secretion in the presence of a pro-inflammatory stimulus such as TNF-α. The potential use of SFN/FB based supplements for the prevention of skin aging and as adjuvants in the treatment of advanced melanoma is suggested. | |||
| No. | Title | Href |
|---|---|---|
| 1 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |
| 2 | The Combination of Sulforaphane and Fernblock® XP Improves Individual Beneficial Effects in Normal and Neoplastic Human Skin Cell Lines. Nutrients. 2020 May 30;12(6):1608. doi: 10.3390/nu12061608. | Click |
