Name | Matrix metalloproteinase-1 | ||
UniProt ID | MMP1_HUMAN | ||
Gene Name | MMP1 | ||
Gene ID | 4312 | ||
Synonyms |
MMP1, CLG, CLGN
|
||
Sequence |
MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPV
VEKLKQMQEFFGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIEN YTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSY TFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDR FYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGY PKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.3.10.16; 8.A.21.3.1; 8.B.14.2.3 | ||
KEGG ID | hsa4312 | ||
TTD ID | T52450 | ||
Pfam | PF00045; PF00413; PF01471; PF03032; PF07998; PF10462; PF12044; PF13582; PF13583; PF13688; PF16313 |
Pair Name | Sulforaphane, Fernblock® XP | |||
Phytochemical | Sulforaphane | |||
Drug | Fernblock® XP | |||
Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
Regulate Info | Down-regulation | Matrix metalloproteinase-1 | Expression | |
Result | SFN/FB was more efficient than SFN or FB alone in inhibiting MMP-1 and -3 production and IL-1β secretion in the presence of a pro-inflammatory stimulus such as TNF-α. The potential use of SFN/FB based supplements for the prevention of skin aging and as adjuvants in the treatment of advanced melanoma is suggested. |
Pair Name | Brassinolid, Doxorubicin | |||
Phytochemical | Brassinolid | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Matrix metalloproteinase-1 | Expression | |
Result | These data indicate that EB, a natural product with widespread occurrence in plants, is pharmacologically active in both drug-sensitive and drug-resistant SCLC cells and acts through the Wnt signaling pathway. |
No. | Title | Href |
---|---|---|
1 | The Combination of Sulforaphane and Fernblock® XP Improves Individual Beneficial Effects in Normal and Neoplastic Human Skin Cell Lines. Nutrients. 2020 May 30;12(6):1608. doi: 10.3390/nu12061608. | Click |
2 | The effect of brassinolide, a plant steroid hormone, on drug resistant small-cell lung carcinoma cells. Biochem Biophys Res Commun. 2017 Nov 4;493(1):783-787. doi: 10.1016/j.bbrc.2017.08.094. | Click |