| Name | Kallikrein-2 | ||
| UniProt ID | KLK2_HUMAN | ||
| Gene Name | KLK2 | ||
| Gene ID | 3817 | ||
| Synonyms |
KLK2, KLK2A2, hGK-1, hK2
|
||
| Sequence |
MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWV
LTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHD LMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLS NDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKP AVYTKVVHYRKWIKDTIAANP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3817 | ||
| TTD ID | T01908 | ||
| Pfam | PF00089; PF09342; PF13365 | ||
| Pair Name | Acteoside, Sorafenib | |||
| Phytochemical | Acteoside | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Kallikrein-2 | Expression | |
| Result | Acteoside exerts an antitumor effect possibly through its up-regulation of p53 levels as well as inhibition of KLK expression and angiogenesis. Acteoside could be useful as an adjunct in the treatment of advanced HCC in the clinic. | |||
| Pair Name | Curcumin, Arsenic oxide (As2O3) | |||
| Phytochemical | Curcumin | |||
| Drug | Arsenic oxide (As2O3) | |||
| Disease Info | [ICD-11: 2C82] | Prostate cancer | Investigative | |
| Regulate Info | Down-regulation | Kallikrein-2 | Expression | |
| Result | The antitumor effects of combination therapy with As2O3 and Curcumin have been displayed on prostate cancer cell lines (LNCaP and PC3), which probably originates from their potential to induce apoptosis and inhibit the growth of prostate cancer cells simultaneously. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Acteoside as a potential therapeutic option for primary hepatocellular carcinoma: a preclinical study. BMC Cancer. 2020 Sep 29;20(1):936. doi: 10.1186/s12885-020-07447-3. | Click |
| 2 | Human prostate cancer cell epithelial-to-mesenchymal transition as a novel target of arsenic trioxide and curcumin therapeutic approach. Tissue Cell. 2022 Jun;76:101805. doi: 10.1016/j.tice.2022.101805. | Click |
