| Name | Interleukin-17A | ||
| UniProt ID | IL17_HUMAN | ||
| Gene Name | IL17A | ||
| Gene ID | 3605 | ||
| Synonyms |
IL17A, CTLA-8, CTLA8, IL-17, IL-17A, IL17, ILA17
|
||
| Sequence |
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3605 | ||
| TTD ID | T22095 | ||
| Pfam | PF06083 | ||
| Pair Name | Dendrobine, Cisplatin | |||
| Phytochemical | Dendrobine | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Interleukin-17A | Expression | |
| Result | Synergism Effect of Dendrobine on Cisplatin in Treatment of H1299 by Modulating the Balance of Treg/Th17 | |||
| Pair Name | Sinapine, Doxorubicin | |||
| Phytochemical | Sinapine | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Interleukin-17A | Expression | |
| Result | Our findings indicated that sinapine played an important role in the downregulation of MDR1 expression through suppression of fibroblast growth factor receptor (FGFR)4/FRS2α-ERK1/2 mediated NF-κB activation in MCF-7/dox cancer cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergism Effect of Dendrobine on Cisplatin in Treatment of H1299 by Modulating the Balance of Treg/Th17. Anticancer Agents Med Chem. 2023;23(1):105-112. doi: 10.2174/1871520622666220520093837. | Click |
| 2 | Sinapine reverses multi-drug resistance in MCF-7/dox cancer cells by downregulating FGFR4/FRS2α-ERK1/2 pathway-mediated NF-κB activation. Phytomedicine. 2016 Mar 15;23(3):267-73. doi: 10.1016/j.phymed.2015.12.017. | Click |
