| Name | Histamine H4 receptor | ||
| UniProt ID | HRH4_HUMAN | ||
| Gene Name | HRH4 | ||
| Gene ID | 59340 | ||
| Synonyms |
HRH4, AXOR35, BG26, GPCR105, GPRv53, H4, H4R, HH4R
|
||
| Sequence |
MPDTNSTINLSLSTRVTLAFFMSLVAFAIMLGNALVILAFVVDKNLRHRSSYFFLNLAIS
DFFVGVISIPLYIPHTLFEWDFGKEICVFWLTTDYLLCTASVYNIVLISYDRYLSVSNAV SYRTQHTGVLKIVTLMVAVWVLAFLVNGPMILVSESWKDEGSECEPGFFSEWYILAITSF LEFVIPVILVAYFNMNIYWSLWKRDHLSRCQSHPGLTAVSSNICGHSFRGRLSSRRSLSA STEVPASFHSERQRRKSSLMFSSRTKMNSNTIASKMGSFSQSDSVALHQREHVELLRARR LAKSLAILLGVFAVCWAPYSLFTIVLSFYSSATGPKSVWYRIAFWLQWFNSFVNPLLYPL CHKRFQKAFLKIFCIKKQPLPSQHSRSVSS |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa59340 | ||
| TTD ID | T26500 | ||
| Pfam | PF00001; PF10320; PF13853; PF17523 | ||
| Pair Name | Vitamin C, GW841819X | |||
| Phytochemical Name | Vitamin C | |||
| Anticancer drug Name | GW841819X | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Down-regulation | Histamine H4 receptor | Expression | |
| Result | This study shows that ascorbate can enhance the efficacy of BET inhibitors, providing a possible clinical solution to challenges arising in phase I trials from the dose-dependent side effects of this class of epigenetic therapy. | |||
| Pair Name | Homoharringtonine, Suberoylanilide hydroxamic acid (SAHA) | |||
| Phytochemical | Homoharringtonine | |||
| Drug | Suberoylanilide hydroxamic acid (SAHA) | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Up-regulation | Histamine H4 receptor | Acetylation | |
| Result | The synergistic effect between HHT and SAHA was blocked partially using a specific anti‑TRAIL antibody. The combination therapy was also found to significantly inhibit the growth of leukemia xenografts in vivo with enhanced apoptosis. These results indicate that, by regulating the induction of TRAIL and activation of the TRAIL apoptotic pathway, it is possible to administer HHT at low concentrations in combination with SAHA as an effective therapeutic approach for the treatment of AML. | |||
| Pair Name | Sulforaphane, Everolimus | |||
| Phytochemical | Sulforaphane | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C94] | Bladder cancer | Investigative | |
| Regulate Info | Up-regulation | Histamine H4 receptor | Expression | |
| Result | The addition of SFN to the long-term everolimus application inhibits resistance development in bladder cancer cells in vitro. Therefore, sulforaphane may hold potential for treating bladder carcinoma in patients with resistance to an mTOR inhibitor. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Vitamin C Sensitizes Melanoma to BET Inhibitors. Cancer Res. 2018 Jan 15;78(2):572-583. doi: 10.1158/0008-5472.CAN-17-2040. | Click |
| 2 | Homoharringtonine and SAHA synergistically enhance apoptosis in human acute myeloid leukemia cells through upregulation of TRAIL and death receptors. Mol Med Rep. 2013 Jun;7(6):1838-44. doi: 10.3892/mmr.2013.1440. | Click |
| 3 | Chronic Sulforaphane Administration Inhibits Resistance to the mTOR-Inhibitor Everolimus in Bladder Cancer Cells. Int J Mol Sci. 2020 Jun 4;21(11):4026. doi: 10.3390/ijms21114026. | Click |
