| Name | Transcription factor HES-1 | ||
| UniProt ID | HES1_HUMAN | ||
| Gene Name | HES1 | ||
| Gene ID | 3280 | ||
| Synonyms |
HES1, HES-1, HHL, HRY, bHLHb39
|
||
| Sequence |
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3280 | ||
| Pfam | PF00010; PF07527; PF20080 | ||
| Pair Name | Beta-Elemene, Gefitinib | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Transcription factor HES-1 | Expression | |
| Result | The findings may have potential implications for treating aggressive and resistant lung cancers. | |||
| Pair Name | Fangchinoline, Everolimus | |||
| Phytochemical | Fangchinoline | |||
| Drug | Everolimus | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Transcription factor HES-1 | Expression | |
| Result | Firstly link CHOP to Notch 3/c-MYC axis-dependent apoptosis and provide the Notch 3/c-MYC/CHOP activation as a promising strategy for mTOR-targeted combination therapy in lung cancer treatment. | |||
| No. | Title | Href |
|---|---|---|
| 1 | β-Elemene Synergizes With Gefitinib to Inhibit Stem-Like Phenotypes and Progression of Lung Cancer via Down-Regulating EZH2. Front Pharmacol. 2018 Nov 30;9:1413. doi: 10.3389/fphar.2018.01413. | Click |
| 2 | Activation of notch 3/c-MYC/CHOP axis regulates apoptosis and promotes sensitivity of lung cancer cells to mTOR inhibitor everolimus. Biochem Pharmacol. 2020 May;175:113921. doi: 10.1016/j.bcp.2020.113921. | Click |
