InterPAD - DETAILS

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA
QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL
LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS
ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

No.	Title	Href
1	Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426.	`Click`
2	Low-dose arsenic trioxide combined with aclacinomycin A synergistically enhances the cytotoxic effect on human acute myelogenous leukemia cell lines by induction of apoptosis. Leuk Lymphoma. 2015;56(11):3159-67. doi: 10.3109/10428194.2015.1011155.	`Click`
3	Anti-proliferation effects of Apatinib in combination with Curcumin in breast cancer cells. Horm Mol Biol Clin Investig. 2022 Sep 5;44(1):27-32. doi: 10.1515/hmbci-2022-0036.	`Click`
4	Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.	`Click`
5	Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.	`Click`
6	Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1.	`Click`

No.

Title

Href

Oleanolic acid increases the anticancer potency of doxorubicin in pancreatic cancer cells. J Biochem Mol Toxicol. 2023 Oct;37(10):e23426. doi: 10.1002/jbt.23426.

Click

Low-dose arsenic trioxide combined with aclacinomycin A synergistically enhances the cytotoxic effect on human acute myelogenous leukemia cell lines by induction of apoptosis. Leuk Lymphoma. 2015;56(11):3159-67. doi: 10.3109/10428194.2015.1011155.

Click

Anti-proliferation effects of Apatinib in combination with Curcumin in breast cancer cells. Horm Mol Biol Clin Investig. 2022 Sep 5;44(1):27-32. doi: 10.1515/hmbci-2022-0036.

Click

Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.

Click

Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway. Cell Death Dis. 2014 Oct 16;5(10):e1465. doi: 10.1038/cddis.2014.429.

Click

Shikonin and 4-hydroxytamoxifen synergistically inhibit the proliferation of breast cancer cells through activating apoptosis signaling pathway in vitro and in vivo. Chin Med. 2020 Mar 10;15:23. doi: 10.1186/s13020-020-00305-1.

Click

Name	Diablo IAP-binding mitochondrial protein
UniProt ID	DBLOH_HUMAN
Gene Name	DIABLO
Gene ID	56616
Synonyms	DIABLO, DFNA64, SMAC
Sequence	MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Pathway Map	`MAP LINK`
KEGG ID	hsa56616
TTD ID	T78150
Pfam	PF09057; PF12735

Pair Name	Oleanolic Acid, Doxorubicin
Phytochemical Name	Oleanolic Acid
Anticancer drug Name	Doxorubicin
Disease Info	[ICD-11: 2C10]	Pancreatic cancer	Investigative
Regulate Info	Up-regulation	Diablo IAP-binding mitochondrial protein	Expression
Result	This approach may increase the efficiency of chemotherapy and reduce unintended side effects by lowering the prescribed dose of DOX.

Pair Name	Capsaicin, Arsenic trioxide
Phytochemical	Capsaicin
Drug	Arsenic trioxide
Disease Info	[ICD-11: 2A60.Z]	Acute myeloid leukemia	Investigative
Regulate Info	Up-regulation	Diablo IAP-binding mitochondrial protein	Expression
Result	Combination index (CI) values were < 1 in all matched combination groups. Additional evaluation of As2O3 combined with ACM as a potential therapeutic benefit for AML seems warranted.

Pair Name	Curcumin, Apatinib
Phytochemical	Curcumin
Drug	Apatinib
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Diablo IAP-binding mitochondrial protein	Expression
Result	Apa-Cur combination therapy exerts more profound anti-proliferation effects on breast cancer cell than Apatinib or Curcumin monotherapy. However, further studies are required to identify other possible signaling pathways and mechanisms involved in the anticancer effects of Apatinib, Curcumin, and Apa-Cur.

Pair Name	Medicarpin, TNF-related apoptosis inducing ligand
Phytochemical	Medicarpin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B33.1]	Myeloid leukemia	Investigative
Regulate Info	Up-regulation	Diablo IAP-binding mitochondrial protein	Expression
Result	Medicarpin, a legume phytoalexin sensitizes myeloid leukemia cells to TRAIL-induced apoptosis through the induction of DR5 and activation of the ROS-JNK-CHOP pathway

Pair Name	Shikonin, 4-hydroxytamoxifen
Phytochemical	Shikonin
Drug	4-hydroxytamoxifen
Disease Info	[ICD-11: 2C60]	Breast cancer	Investigative
Regulate Info	Up-regulation	Diablo IAP-binding mitochondrial protein	Expression
Result	The combination of SK and 4-OHT shows highly efficient anticancer effects on breast cancer therapy. SK may be a promising candidate as an adjuvant to 4-OHT for breast cancer treatments, especially for ER- breast cancer.