| Name | Claudin-1 | ||
| UniProt ID | CLD1_HUMAN | ||
| Gene Name | CLDN1 | ||
| Gene ID | 9076 | ||
| Synonyms |
CLDN1, CLD1, ILVASC, SEMP1
|
||
| Sequence |
MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTG
QIQCKVFDSLLNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAV IGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGA LLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.H.1.1.14 | ||
| KEGG ID | hsa9076 | ||
| Pfam | PF00032; PF00654; PF00822; PF06687; PF11021; PF13903 | ||
| Pair Name | Luteolin, Paclitaxel | |||
| Phytochemical | Luteolin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2B70] | Esophageal cancer | Investigative | |
| Regulate Info | Up-regulation | Claudin-1 | Expression | |
| Result | The molecular mechanism of inhibiting cell migration and EMT processes may be related to the inhibition of SIRT1, and the mechanism of apoptosis induction is associated with the reactive oxygen species (ROS)/c-Jun N-terminal kinase (JNK) pathway-mediated activation of mitochondrial apoptotic pathway. | |||
| Pair Name | Sulforaphane, Cisplatin | |||
| Phytochemical | Sulforaphane | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Claudin-1 | Expression | |
| Result | The results of the current study suggests that CIS when supplemented with SFN, inhibits metastasis and stemness potential of TNBC cells by down regulating SIRTs-mediated EMT cascade. Overall this study affirms that, this novel combination could be a promising strategy against SIRT-mediated TNBC metastasis and CIS-resistance. | |||
| Pair Name | Sulforaphane, Gefitinib | |||
| Phytochemical | Sulforaphane | |||
| Drug | Gefitinib | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Claudin-1 | Expression | |
| Result | SFN overcame T790M-mediated gefitinib resistance in vitro through EMT. Thus, a combination of gefitinib and SFN may be a beneficial treatment strategy for lung cancer patients with acquired resistance due to T790M mutation. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Luteolin combined with low-dose paclitaxel synergistically inhibits epithelial-mesenchymal transition and induces cell apoptosis on esophageal carcinoma in vitro and in vivo. Phytother Res. 2021 Nov;35(11):6228-6240. doi: 10.1002/ptr.7267. | Click |
| 2 | Sulforaphane-cisplatin combination inhibits the stemness and metastatic potential of TNBCs via down regulation of sirtuins-mediated EMT signaling axis. Phytomedicine. 2021 Apr;84:153492. doi: 10.1016/j.phymed.2021.153492. | Click |
| 3 | Sulforaphane overcomes T790M-mediated gefitinib resistance in vitro through epithelial-mesenchymal transition. J Physiol Pharmacol. 2021 Oct;72(5). doi: 10.26402/jpp.2021.5.09. | Click |
