TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Threonine-protein kinase Chk2
UniProt ID CHK2_HUMAN
Gene Name CHEK2
Gene ID 11200
Synonyms
CHEK2, CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, TPDS4, hCds1
Sequence
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS
CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR
RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER
KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE
DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC
LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA
LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA
AVL
Pathway Map MAP LINK
KEGG ID hsa11200
TTD ID T28713
Pfam PF00069; PF00498; PF01163; PF01636; PF03109; PF06293; PF07714; PF10707; PF12330; PF14531
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 129
Pair Name Licochalcone B, TNF-related apoptosis inducing ligand
Phytochemical Licochalcone B
Drug TNF-related apoptosis inducing ligand
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Threonine-protein kinase Chk2 Phosphorylation
Result LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC.
Combination Pair ID: 1033
Pair Name Patchouli alcohol, Vincristine
Phytochemical Patchouli alcohol
Drug Vincristine
Disease Info [ICD-11: 2C25.Z] Lung cancer Investigative
Regulate Info Up-regulation Threonine-protein kinase Chk2 Phosphorylation
Result Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage
Combination Pair ID: 470
Pair Name Gossypol, Idarubicin
Phytochemical Gossypol
Drug Idarubicin
Disease Info [ICD-11: 2A60.Z] Acute myeloid leukemia Investigative
Regulate Info Down-regulation Threonine-protein kinase Chk2 Phosphorylation
Result These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML.
Combination Pair ID: 902
Pair Name Sulforaphane, Gemcitabine
Phytochemical Sulforaphane
Drug Gemcitabine
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation Threonine-protein kinase Chk2 Phosphorylation
Result Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity
03. Reference
No. Title Href
1 Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. Click
2 Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. Click
3 Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. Click
4 Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity. Cells. 2023 Feb 22;12(5):687. doi: 10.3390/cells12050687. Click
It has been None visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP