Name | Threonine-protein kinase Chk2 | ||
UniProt ID | CHK2_HUMAN | ||
Gene Name | CHEK2 | ||
Gene ID | 11200 | ||
Synonyms |
CHEK2, CDS1, CHK2, HuCds1, LFS2, PP1425, RAD53, TPDS4, hCds1
|
||
Sequence |
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSSQSSHSSSGTL
SSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQDGFANLECVNDNYWFGRDKS CEYCFDEPLLKRTDKYRTYSKKHFRIFREVGPKNSYIAYIEDHSGNGTFVNTELVGKGKR RPLNNNSEIALSLSRNKVFVFFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFER KTCKKVAIKIISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEE DCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFIC LSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEA LRHPWLQDEDMKRKFQDLLSEENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCA AVL |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa11200 | ||
TTD ID | T28713 | ||
Pfam | PF00069; PF00498; PF01163; PF01636; PF03109; PF06293; PF07714; PF10707; PF12330; PF14531 |
Pair Name | Licochalcone B, TNF-related apoptosis inducing ligand | |||
Phytochemical | Licochalcone B | |||
Drug | TNF-related apoptosis inducing ligand | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Threonine-protein kinase Chk2 | Phosphorylation | |
Result | LCB exhibits cytotoxic activity through modulation of the Akt/mTOR, ER stress and MAPK pathways in HCC cells and effectively enhances TRAIL sensitivity through the upregulation of DR5 expression in ERK- and JNK-dependent manner. Combination therapy with LCB and TRAIL may be an alternative treatment strategy for HCC. |
Pair Name | Patchouli alcohol, Vincristine | |||
Phytochemical | Patchouli alcohol | |||
Drug | Vincristine | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Up-regulation | Threonine-protein kinase Chk2 | Phosphorylation | |
Result | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage |
Pair Name | Gossypol, Idarubicin | |||
Phytochemical | Gossypol | |||
Drug | Idarubicin | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Threonine-protein kinase Chk2 | Phosphorylation | |
Result | These findings suggest that combinatorial therapy with AT-101 and IDA selectively eliminates leukemia stem-like cells both in vitro and in vivo, representing a potent and alternative salvage therapy for the treatment of relapsed and refractory patients with AML. |
Pair Name | Sulforaphane, Gemcitabine | |||
Phytochemical | Sulforaphane | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | Threonine-protein kinase Chk2 | Phosphorylation | |
Result | Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity |
No. | Title | Href |
---|---|---|
1 | Licochalcone B induces DNA damage, cell cycle arrest, apoptosis, and enhances TRAIL sensitivity in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Sep 25;365:110076. doi: 10.1016/j.cbi.2022.110076. | Click |
2 | Patchouli alcohol induces G0 /G1 cell cycle arrest and apoptosis in vincristine-resistant non-small cell lung cancer through ROS-mediated DNA damage. Thorac Cancer. 2023 Jul;14(21):2007-2017. doi: 10.1111/1759-7714.14982. | Click |
3 | Synthetic lethality of combined AT-101 with idarubicin in acute myeloid leukemia via blockade of DNA repair and activation of intrinsic apoptotic pathway. Cancer Lett. 2019 Oct 1;461:31-43. doi: 10.1016/j.canlet.2019.07.003. | Click |
4 | Sulforaphane Potentiates Gemcitabine-Mediated Anti-Cancer Effects against Intrahepatic Cholangiocarcinoma by Inhibiting HDAC Activity. Cells. 2023 Feb 22;12(5):687. doi: 10.3390/cells12050687. | Click |