| Name | Cofilin-1 | ||
| UniProt ID | COF1_HUMAN | ||
| Gene Name | CFL1 | ||
| Gene ID | 1072 | ||
| Synonyms |
CFL1, CFL, HEL-S-15, cofilin
|
||
| Sequence |
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV
GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 9.A.14.13.35 | ||
| KEGG ID | hsa1072 | ||
| Pfam | PF00241 | ||
| Pair Name | Alliin, Paclitaxel | |||
| Phytochemical | Alliin | |||
| Drug | Paclitaxel | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Cofilin-1 | Expression | |
| Result | The data obtained in the present study allow us to conclude that CFL1 itself does not translocate actin into the cell nucleus but this transport requires the functional expression of IPO9. | |||
| Pair Name | Cepharanthine, Epirubicin | |||
| Phytochemical | Cepharanthine | |||
| Drug | Epirubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Up-regulation | Cofilin-1 | Expression | |
| Result | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis | |||
| Pair Name | Platycodin D, Histone deacetylase inhibitor | |||
| Phytochemical | Platycodin D | |||
| Drug | Histone deacetylase inhibitor | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Cofilin-1 | Phosphorylation | |
| Result | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation | |||
| No. | Title | Href |
|---|---|---|
| 1 | Downregulation of importin-9 protects MCF-7 cells against apoptosis induced by the combination of garlic-derived alliin and paclitaxel. Oncol Rep. 2016 May;35(5):3084-93. doi: 10.3892/or.2016.4628. | Click |
| 2 | Cepharanthine sensitizes human triple negative breast cancer cells to chemotherapeutic agent epirubicin via inducing cofilin oxidation-mediated mitochondrial fission and apoptosis. Acta Pharmacol Sin. 2022 Jan;43(1):177-193. doi: 10.1038/s41401-021-00715-3. | Click |
| 3 | Platycodin D reverses histone deacetylase inhibitor resistance in hepatocellular carcinoma cells by repressing ERK1/2-mediated cofilin-1 phosphorylation. Phytomedicine. 2021 Feb;82:153442. doi: 10.1016/j.phymed.2020.153442. | Click |
