| Name | Programmed cell death 1 ligand 1 | ||
| UniProt ID | PD1L1_HUMAN | ||
| Gene Name | CD274 | ||
| Gene ID | 29126 | ||
| Synonyms |
CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
|
||
| Sequence |
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.23.5.1 | ||
| KEGG ID | hsa29126 | ||
| TTD ID | T90457 | ||
| Pfam | PF00047; PF06328; PF07654; PF07679; PF07686; PF08205; PF13895; PF13927; PF20578 | ||
| Pair Name | All-trans retinoic acid, Anti-PD-L1 antibody | |||
| Phytochemical | All-trans-retinoic acid | |||
| Drug | Anti-PD-L1 antibody | |||
| Disease Info | [ICD-11: 2C77] | Cervical cancer | Investigative | |
| Regulate Info | Down-regulation | Programmed cell death 1 ligand 1 | Expression | |
| Result | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. | |||
| Pair Name | Honokiol, Rapamycin | |||
| Phytochemical | Honokiol | |||
| Drug | Rapamycin | |||
| Disease Info | [ICD-11: 2C90.0] | Renal cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Programmed cell death 1 ligand 1 | Expression | |
| Result | Honokiol can effectively overcome the limitation of Rapamycin treatment alone; and the combination treatment can markedly restrict the growth of RCC, with particular importance to post-transplantation renal cancer. | |||
| Pair Name | Withaferin A, Immune checkpoint blockers | |||
| Phytochemical | Withaferin A | |||
| Drug | Immune checkpoint blockers | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Programmed cell death 1 ligand 1 | Expression | |
| Result | Our results demonstrate that WFA sensitizes NSCLC to α-PD-L1 in part via activation of ROS. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. | Click |
| 2 | A Novel Combination Treatment with Honokiol and Rapamycin Effectively Restricts c-Met-Induced Growth of Renal Cancer Cells, and also Inhibits the Expression of Tumor Cell PD-L1 Involved in Immune Escape. Cancers (Basel). 2020 Jul 3;12(7):1782. doi: 10.3390/cancers12071782. | Click |
| 3 | Withaferin A Increases the Effectiveness of Immune Checkpoint Blocker for the Treatment of Non-Small Cell Lung Cancer. Cancers (Basel). 2023 Jun 7;15(12):3089. doi: 10.3390/cancers15123089. | Click |
