TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Programmed cell death 1 ligand 1
UniProt ID PD1L1_HUMAN
Gene Name CD274
Gene ID 29126
Synonyms
CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1LG1, PDL1, hPD-L1
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
Pathway Map MAP LINK
T.C. Number 8.A.23.5.1
KEGG ID hsa29126
TTD ID T90457
Pfam PF00047; PF06328; PF07654; PF07679; PF07686; PF08205; PF13895; PF13927; PF20578
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 517
Pair Name All-trans retinoic acid, Anti-PD-L1 antibody
Phytochemical All-trans-retinoic acid
Drug Anti-PD-L1 antibody
Disease Info [ICD-11: 2C77] Cervical cancer Investigative
Regulate Info Down-regulation Programmed cell death 1 ligand 1 Expression
Result Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer.
Combination Pair ID: 765
Pair Name Honokiol, Rapamycin
Phytochemical Honokiol
Drug Rapamycin
Disease Info [ICD-11: 2C90.0] Renal cell carcinoma Investigative
Regulate Info Down-regulation Programmed cell death 1 ligand 1 Expression
Result Honokiol can effectively overcome the limitation of Rapamycin treatment alone; and the combination treatment can markedly restrict the growth of RCC, with particular importance to post-transplantation renal cancer.
Combination Pair ID: 796
Pair Name Withaferin A, Immune checkpoint blockers
Phytochemical Withaferin A
Drug Immune checkpoint blockers
Disease Info [ICD-11: 2C25] Lung cancer Investigative
Regulate Info Up-regulation Programmed cell death 1 ligand 1 Expression
Result Our results demonstrate that WFA sensitizes NSCLC to α-PD-L1 in part via activation of ROS.
03. Reference
No. Title Href
1 Inhibition of myeloid-derived suppressive cell function with all-trans retinoic acid enhanced anti-PD-L1 efficacy in cervical cancer. Sci Rep. 2022 Jun 10;12(1):9619. doi: 10.1038/s41598-022-13855-1. Click
2 A Novel Combination Treatment with Honokiol and Rapamycin Effectively Restricts c-Met-Induced Growth of Renal Cancer Cells, and also Inhibits the Expression of Tumor Cell PD-L1 Involved in Immune Escape. Cancers (Basel). 2020 Jul 3;12(7):1782. doi: 10.3390/cancers12071782. Click
3 Withaferin A Increases the Effectiveness of Immune Checkpoint Blocker for the Treatment of Non-Small Cell Lung Cancer. Cancers (Basel). 2023 Jun 7;15(12):3089. doi: 10.3390/cancers15123089. Click
It has been 165527 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP