| Name | Signal transducer CD24 | ||
| UniProt ID | CD24_HUMAN | ||
| Gene Name | CD24 | ||
| Gene ID | 100133941 | ||
| Synonyms |
CD24, CD24A
|
||
| Sequence |
MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGG
ALQSTASLFVVSLSLLHLYS |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.128.7.1 | ||
| KEGG ID | hsa100133941 | ||
| TTD ID | T65906 | ||
| Pfam | PF06679; PF14984 | ||
| Pair Name | Curcumin, Irinotecan | |||
| Phytochemical | Curcumin | |||
| Drug | Irinotecan | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Signal transducer CD24 | Expression | |
| Result | The present data demonstrated that curcumin attenuated resistance to chemotherapeutic drugs through induction of apoptosis of CSCs among colon cancer cells. These findings may provide novel evidence for the therapeutic application of curcumin in CRC intervention. | |||
