| Name | Cyclic AMP-dependent transcription factor ATF-3 | ||
| UniProt ID | ATF3_HUMAN | ||
| Gene Name | ATF3 | ||
| Gene ID | 467 | ||
| Synonyms |
ATF3
|
||
| Sequence |
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ S |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa467 | ||
| TTD ID | T11966 | ||
| Pfam | PF00170; PF01159; PF01786; PF03131; PF07716; PF07792; PF09726 | ||
| Pair Name | Zerumbone, Celecoxib | |||
| Phytochemical | Zerumbone | |||
| Drug | Celecoxib | |||
| Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
| Regulate Info | Up-regulation | Cyclic AMP-dependent transcription factor ATF-3 | Expression | |
| Result | Our results provide novel insights into the role of ATF3 as an essential transcription factor for p53-independent DR5 induction upon both ZER and CCB treatment, and this may be a useful biomarker for TRAIL-based anticancer therapy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Role of activating transcription factor 3 (ATF3) in endoplasmic reticulum (ER) stress-induced sensitization of p53-deficient human colon cancer cells to tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL)-mediated apoptosis through up-regulation of death receptor 5 (DR5) by zerumbone and celecoxib. J Biol Chem. 2014 Aug 1;289(31):21544-61. doi: 10.1074/jbc.M114.558890. | Click |
