| Name | Protein Wnt-3a | ||
| UniProt ID | WNT3A_HUMAN | ||
| Gene Name | WNT3A | ||
| Gene ID | 89780 | ||
| Synonyms |
WNT3A
|
||
| Sequence |
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa89780 | ||
| Pfam | PF00110 | ||
| Pair Name | Carnosic acid, Anti-PD-1 antibody | |||
| Phytochemical Name | Carnosic acid | |||
| Anticancer drug Name | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Protein Wnt-3a | Expression | |
| Result | CA-NBF combined with anti-PD-1 have stronger immunomodulatory and anticancer effects without increasing biological toxicity. | |||
| Pair Name | Puerarin, Cisplatin | |||
| Phytochemical | Puerarin | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Protein Wnt-3a | Activity | |
| Result | Taking these results together, we can draw the conclusion that the PUE enhances the anti-tumor effect of DDP on the drug-resistant A549 cancer in vivo and in vitro through activation of the Wnt signaling pathway. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Carnosic acid nanocluster-based framework combined with PD-1 inhibitors impeded tumorigenesis and enhanced immunotherapy in hepatocellular carcinoma. Funct Integr Genomics. 2024 Jan 6;24(1):5. doi: 10.1007/s10142-024-01286-2. | Click |
| 2 | Puerarin Enhances the Anti-Tumor Effect of Cisplatin on Drug-Resistant A549 Cancer in vivo and in vitro Through Activation of the Wnt Signaling Pathway. Cancer Manag Res. 2020 Jul 24;12:6279-6289. doi: 10.2147/CMAR.S253327. | Click |
