Name | Superoxide dismutase | ||
UniProt ID | SODM_HUMAN | ||
Gene Name | SOD2 | ||
Gene ID | 6648 | ||
Synonyms |
SOD2, GC1, GClnc1, IPO-B, IPOB, MNSOD, MVCD6, Mn-SOD
|
||
Sequence |
MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.36.4.2 | ||
KEGG ID | hsa6648 | ||
TTD ID | T89147 | ||
Pfam | PF00081; PF02777 |
Pair Name | Mangiferin, Cisplatin | |||
Phytochemical Name | Mangiferin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | Nephrotoxicity | Investigative | ||
Regulate Info | Up-regulation | Superoxide dismutase | Expression | |
Result | The study reveals a mechanistic basis of mangiferin action against cisplatin induced nephrotoxicity. Since Mangiferin shows synergistic anticancer activity with cisplatin, it can be considered as a promising drug candidate, to be used in combination with cisplatin. |
Pair Name | Artesunate, TP-0903 | |||
Phytochemical | Artesunate | |||
Drug | TP-0903 | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Superoxide dismutase | Expression | |
Result | Synergistic interactions between TP-0903 and ART indicate that combination approaches involving these compounds can have therapeutic prospects for TNBC treatment. |
Pair Name | Luteolin, SMC3 | |||
Phytochemical | Luteolin | |||
Drug | SMC3 | |||
Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Superoxide dismutase | Expression | |
Result | The results suggest that combination of SMC3 and luteolin is an effective approach for improving the anticancer value of SMC3, which has implications in cancer prevention and therapy. |
Pair Name | Parthenolide, Doxorubicin | |||
Phytochemical | Parthenolide | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Superoxide dismutase | Expression | |
Result | PN prevented the acquisition of resistance induced by Mitox and DOX treatment in MDA-MB231 cells. This effect was mediated by inhibition of overexpression of both Nrf2 and its target activities. Therefore, within MDA-MB231 cell lines, PN not only exerts toxic effects on stem-like cells, which are responsible for tumour recurrence, but also prevents drug resistance |
No. | Title | Href |
---|---|---|
1 | Mangiferin Ameliorates Cisplatin Induced Acute Kidney Injury by Upregulating Nrf-2 via the Activation of PI3K and Exhibits Synergistic Anticancer Activity With Cisplatin. Front Pharmacol. 2018 Jun 18;9:638. doi: 10.3389/fphar.2018.00638. | Click |
2 | Mesenchymal-epithelial transition and AXL inhibitor TP-0903 sensitise triple-negative breast cancer cells to the antimalarial compound, artesunate. Sci Rep. 2024 Jan 3;14(1):425. doi: 10.1038/s41598-023-50710-3. | Click |
3 | Attenuating Smac mimetic compound 3-induced NF-kappaB activation by luteolin leads to synergistic cytotoxicity in cancer cells. J Cell Biochem. 2009 Dec 1;108(5):1125-31. doi: 10.1002/jcb.22346. | Click |
4 | Parthenolide prevents resistance of MDA-MB231 cells to doxorubicin and mitoxantrone: the role of Nrf2. Cell Death Discov. 2017;3:17078. Published 2017 Dec 4. doi:10.1038/cddiscovery.2017.78 | Click |