
| Name | Suppressor of cytokine signaling 3 | ||
| UniProt ID | SOCS3_HUMAN | ||
| Gene Name | SOCS3 | ||
| Gene ID | 9021 | ||
| Synonyms |
SOCS3, ATOD4, CIS3, Cish3, SOCS-3, SSI-3, SSI3
|
||
| Sequence |
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSR PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa9021 | ||
| TTD ID | T92477 | ||
| Pfam | PF00017; PF07525 | ||
| Pair Name | Resveratrol, Temozolomide | |||
| Phytochemical | Resveratrol | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Up-regulation | Suppressor of cytokine signaling 3 | Expression | |
| Result | Res inhibited STAT3 signaling through modulation of PIAS3, SHP1, SHP2, and SOCS3, thereby attenuating tumor growth and increasing sensitivity to TMZ. Therefore, Res is an ideal candidate to be used in TMZ combined chemotherapy for GBM. | |||