
| Name | Mothers against decapentaplegic homolog 3 | ||
| UniProt ID | SMAD3_HUMAN | ||
| Gene Name | SMAD3 | ||
| Gene ID | 4088 | ||
| Synonyms |
SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, hMAD-3, hSMAD3, mad3
|
||
| Sequence |
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR CSSVS |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4088 | ||
| TTD ID | T35445 | ||
| Pfam | PF03165; PF03166; PF10401 | ||
| Pair Name | Usnic acid, Bleomycin | |||
| Phytochemical Name | Usnic acid | |||
| Anticancer drug Name | Bleomycin | |||
| Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
| Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 3 | Expression | |
| Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin | |||
| Pair Name | Thymoquinone, Gemcitabine | |||
| Phytochemical | Thymoquinone | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 3 | Expression | |
| Result | TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
| 2 | Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. | Click |