Name | Mothers against decapentaplegic homolog 3 | ||
UniProt ID | SMAD3_HUMAN | ||
Gene Name | SMAD3 | ||
Gene ID | 4088 | ||
Synonyms |
SMAD3, HSPC193, HsT17436, JV15-2, LDS1C, LDS3, MADH3, hMAD-3, hSMAD3, mad3
|
||
Sequence |
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR CSSVS |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa4088 | ||
TTD ID | T35445 | ||
Pfam | PF03165; PF03166; PF10401 |
Pair Name | Usnic acid, Bleomycin | |||
Phytochemical Name | Usnic acid | |||
Anticancer drug Name | Bleomycin | |||
Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
Regulate Info | Up-regulation | Mothers against decapentaplegic homolog 3 | Expression | |
Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin |
Pair Name | Thymoquinone, Gemcitabine | |||
Phytochemical | Thymoquinone | |||
Drug | Gemcitabine | |||
Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 3 | Expression | |
Result | TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role. |
No. | Title | Href |
---|---|---|
1 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
2 | Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. | Click |