| Name | Mothers against decapentaplegic homolog 2 | ||
| UniProt ID | SMAD2_HUMAN | ||
| Gene Name | SMAD2 | ||
| Gene ID | 4087 | ||
| Synonyms |
SMAD2, CHTD8, JV18, JV18-1, LDS6, MADH2, MADR2, hMAD-2, hSMAD2
|
||
| Sequence |
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa4087 | ||
| Pfam | PF03165; PF03166; PF10401 | ||
| Pair Name | Usnic acid, Bleomycin | |||
| Phytochemical Name | Usnic acid | |||
| Anticancer drug Name | Bleomycin | |||
| Disease Info | [ICD-11: 2F94] | Ascitic tumor | Investigative | |
| Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 2 | Expression | |
| Result | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin | |||
| Pair Name | Luteolin, Bortezomib | |||
| Phytochemical | Luteolin | |||
| Drug | Bortezomib | |||
| Disease Info | [ICD-11: 2A83] | Multiple myeloma | Investigative | |
| Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 2 | Phosphorylation | |
| Result | Our findings suggested that LUT is a promising agent that manifests MMSCs to overcome BTZ resistance, alone or in combination with BTZ, and thus, is a potential therapeutic drug for the treatment of MM. | |||
| Pair Name | Patchouli alcohol, Cisplatin | |||
| Phytochemical | Patchouli alcohol | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C30] | Melanoma | Investigative | |
| Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 2 | Phosphorylation | |
| Result | The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells | |||
| Pair Name | Thymoquinone, Gemcitabine | |||
| Phytochemical | Thymoquinone | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | Mothers against decapentaplegic homolog 2 | Expression | |
| Result | TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. | Click |
| 2 | Luteolin inhibits the TGF-β signaling pathway to overcome bortezomib resistance in multiple myeloma. Cancer Lett. 2023 Feb 1;554:216019. doi: 10.1016/j.canlet.2022.216019. | Click |
| 3 | The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells. J Cell Mol Med. 2023 May;27(10):1423-1435. doi: 10.1111/jcmm.17745. | Click |
| 4 | Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. | Click |
