TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Mothers against decapentaplegic homolog 2
UniProt ID SMAD2_HUMAN
Gene Name SMAD2
Gene ID 4087
Synonyms
SMAD2, CHTD8, JV18, JV18-1, LDS6, MADH2, MADR2, hMAD-2, hSMAD2
Sequence
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
Pathway Map MAP LINK
KEGG ID hsa4087
Pfam PF03165; PF03166; PF10401
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 503
Pair Name Usnic acid, Bleomycin
Phytochemical Name Usnic acid
Anticancer drug Name Bleomycin
Disease Info [ICD-11: 2F94] Ascitic tumor Investigative
Regulate Info Down-regulation Mothers against decapentaplegic homolog 2 Expression
Result Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 253
Pair Name Patchouli alcohol, Cisplatin
Phytochemical Patchouli alcohol
Drug Cisplatin
Disease Info [ICD-11: 2C30] Melanoma Investigative
Regulate Info Down-regulation Mothers against decapentaplegic homolog 2 Phosphorylation
Result The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells
Combination Pair ID: 757
Pair Name Thymoquinone, Gemcitabine
Phytochemical Thymoquinone
Drug Gemcitabine
Disease Info [ICD-11: 2C10.Z] Pancreatic cancer Investigative
Regulate Info Down-regulation Mothers against decapentaplegic homolog 2 Expression
Result TQ can promote apoptosis, inhibit migration, invasion, and metastasis, and enhance the sensitivity to GEM. The underlying mechanism may involve the regulation of ECM production through the TGFβ/Smad pathway, in which HIF-1α plays a key role.
Combination Pair ID: 410
Pair Name Luteolin, Bortezomib
Phytochemical Luteolin
Drug Bortezomib
Disease Info [ICD-11: 2A83.1] Multiple myeloma Investigative
Regulate Info Down-regulation Mothers against decapentaplegic homolog 2 Phosphorylation
Result Our findings suggested that LUT is a promising agent that manifests MMSCs to overcome BTZ resistance, alone or in combination with BTZ, and thus, is a potential therapeutic drug for the treatment of MM.
03. Reference
No. Title Href
1 Effect-enhancing and toxicity-reducing activity of usnic acid in ascitic tumor-bearing mice treated with bleomycin. Int Immunopharmacol. 2017 May;46:146-155. doi: 10.1016/j.intimp.2017.03.004. Click
2 The effects of patchouli alcohol and combination with cisplatin on proliferation, apoptosis and migration in B16F10 melanoma cells. J Cell Mol Med. 2023 May;27(10):1423-1435. doi: 10.1111/jcmm.17745. Click
3 Thymoquinone affects the gemcitabine sensitivity of pancreatic cancer by regulating collagen via hypoxia inducible factor-1α. Front Pharmacol. 2023 May 31;14:1138265. doi: 10.3389/fphar.2023.1138265. Click
4 Luteolin inhibits the TGF-β signaling pathway to overcome bortezomib resistance in multiple myeloma. Cancer Lett. 2023 Feb 1;554:216019. doi: 10.1016/j.canlet.2022.216019. Click
It has been 601527 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP