Name | Stearoyl-CoA desaturase | ||
UniProt ID | SCD_HUMAN | ||
Gene Name | SCD | ||
Gene ID | 6319 | ||
Synonyms |
SCD, FADS5, MSTP008, SCD1, SCDOS, hSCD1
|
||
Sequence |
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGE TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG |
||
Pathway Map | MAP LINK | ||
T.C. Number | 1.B.38.4.2; 3.A.1.134.3; 3.A.25.1.1; 3.A.6.1.1; 3.A.6.3.1; 8.A.3.2.2; 8.A.3.2.3; 8.A.9.1.3 | ||
KEGG ID | hsa6319 | ||
Pfam | PF21581 |
Pair Name | (20S)-Protopanaxatriol, EGFR-TKI | |||
Phytochemical | (20S)-Protopanaxatriol | |||
Drug | EGFR-TKI | |||
Disease Info | [ICD-11: 2C25.Z] | Lung cancer | Investigative | |
Regulate Info | Down-regulation | Stearoyl-CoA desaturase | Expression | |
Result | Our findings uncover a link between lipid metabolic reprogramming and EGFR-TKI resistance, confirmed that combination target both EGFR and abnormal lipid metabolism maybe a promising therapy for EGFR-TKI resistance and highlighting the possibility of monitoring lipid accumulation in tumors for predicting drug resistance. |
Pair Name | Caffeic acid phenethyl ester, Doxorubicin | |||
Phytochemical | Caffeic acid phenethyl ester | |||
Drug | Doxorubicin | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Down-regulation | Stearoyl-CoA desaturase | Expression | |
Result | Our results suggest that CAPE treatment reversed DOX resistance in breast cancer cells, at least in part by inhibiting Akt/mTOR/SREBP1 pathway-mediated lipid metabolism, indicating that CAPE may be an effective substance to assist in the treatment of breast cancer. |
No. | Title | Href |
---|---|---|
1 | Co-administration of 20(S)-protopanaxatriol (g-PPT) and EGFR-TKI overcomes EGFR-TKI resistance by decreasing SCD1 induced lipid accumulation in non-small cell lung cancer. J Exp Clin Cancer Res. 2019 Mar 15;38(1):129. doi: 10.1186/s13046-019-1120-4. | Click |
2 | Caffeic acid phenethyl ester reverses doxorubicin resistance in breast cancer cells via lipid metabolism regulation at least partly by suppressing the Akt/mTOR/SREBP1 pathway. Kaohsiung J Med Sci. 2023 Jun;39(6):605-615. doi: 10.1002/kjm2.12675. | Click |