TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name E3 ubiquitin-protein ligase RNF181
UniProt ID RN181_HUMAN
Gene Name RNF181
Gene ID 51255
Synonyms
RNF181, HSPC238
Sequence
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL
PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Pathway Map MAP LINK
KEGG ID hsa51255
Pfam PF00097; PF04423; PF11789; PF12678; PF12861; PF12906; PF13445; PF13639; PF13920; PF13923; PF14447; PF14634; PF15750; PF17120; PF17123; PF21039
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 439
Pair Name alpha-Mangostin, Sorafenib
Phytochemical alpha-Mangostin
Drug Sorafenib
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Up-regulation E3 ubiquitin-protein ligase RNF181 Expression
Result Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy.
03. Reference
No. Title Href
1 Synergistic effects of α-Mangostin and sorafenib in hepatocellular carcinoma: New insights into α-mangostin cytotoxicity. Biochem Biophys Res Commun. 2021 Jun 18;558:14-21. doi: 10.1016/j.bbrc.2021.04.047. Click
It has been 448795 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP