
| Name | E3 ubiquitin-protein ligase RNF181 | ||
| UniProt ID | RN181_HUMAN | ||
| Gene Name | RNF181 | ||
| Gene ID | 51255 | ||
| Synonyms |
RNF181, HSPC238
|
||
| Sequence |
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa51255 | ||
| Pfam | PF00097; PF04423; PF11789; PF12678; PF12861; PF12906; PF13445; PF13639; PF13920; PF13923; PF14447; PF14634; PF15750; PF17120; PF17123; PF21039 | ||
| Pair Name | alpha-Mangostin, Sorafenib | |||
| Phytochemical | alpha-Mangostin | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | E3 ubiquitin-protein ligase RNF181 | Expression | |
| Result | Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy. | |||