Name | E3 ubiquitin-protein ligase RNF181 | ||
UniProt ID | RN181_HUMAN | ||
Gene Name | RNF181 | ||
Gene ID | 51255 | ||
Synonyms |
RNF181, HSPC238
|
||
Sequence |
MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa51255 | ||
Pfam | PF00097; PF04423; PF11789; PF12678; PF12861; PF12906; PF13445; PF13639; PF13920; PF13923; PF14447; PF14634; PF15750; PF17120; PF17123; PF21039 |
Pair Name | alpha-Mangostin, Sorafenib | |||
Phytochemical | alpha-Mangostin | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Up-regulation | E3 ubiquitin-protein ligase RNF181 | Expression | |
Result | Our results highlight the synergistic effect of the combination of sorafenib and α-Mangostin, which indicates a potential treatment for advanced HCC for patients that are not sensitive to sorafenib therapy. |