
| Name | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 | ||
| UniProt ID | PDK1_HUMAN | ||
| Gene Name | PDK1 | ||
| Gene ID | 5163 | ||
| Synonyms |
PDK1
|
||
| Sequence |
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW CVPSREPKDMTTFRSA |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 8.A.188.1.1 | ||
| KEGG ID | hsa5163 | ||
| TTD ID | T15776 | ||
| Pfam | PF02518; PF10436 | ||
| Pair Name | Ginsenoside Rg3, Sorafenib | |||
| Phytochemical | Ginsenoside Rg3 | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 | Phosphorylation | |
| Result | These findings suggest a promising strategy for HCC treatment, which could be performed in a sufficiently frequent manner. | |||
| Pair Name | Beta-Elemene, Fluorouracil | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Fluorouracil | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 | Phosphorylation | |
| Result | The conclusion obtained, considering that the results suggest that the combination may be important specifically in the treatment of TNBC. | |||
| Pair Name | Eriocalyxin B, Gemcitabine | |||
| Phytochemical | Eriocalyxin B | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 | Phosphorylation | |
| Result | Gem and EriB (or Isodon extract) taken together in combination regulated PDK1/AKT1/caspase and JNK signaling and promoted apoptosis synergistically, which may contribute to the much increased anti-proliferative activity compared to either agent alone. | |||
| Pair Name | Shikonin, Gemcitabine | |||
| Phytochemical | Shikonin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Down-regulation | [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 | Expression | |
| Result | These results indicate that shikonin reduced MCT4 expression and activation, resulting in inhibition of aerobic glycolysis in CAFs and overcoming CAF-induced gemcitabine resistance in PC. Shikonin is a promising chemosensitizing phytochemical agent when used in combination with gemcitabine for PC treatment. The results suggest that disrupting the metabolic coupling between cancer cells and stromal cells might provide an attractive strategy for improving gemcitabine efficacy. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Synergistic anticancer activity of 20(S)-Ginsenoside Rg3 and Sorafenib in hepatocellular carcinoma by modulating PTEN/Akt signaling pathway. Biomed Pharmacother. 2018 Jan;97:1282-1288. doi: 10.1016/j.biopha.2017.11.006. | Click |
| 2 | β-Elemene Enhances the Chemotherapeutic Effect of 5-Fluorouracil in Triple-Negative Breast Cancer via PI3K/AKT, RAF-MEK-ErK, and NF-κB Signaling Pathways. Onco Targets Ther. 2020 Jun 9;13:5207-5222. doi: 10.2147/OTT.S242820. | Click |
| 3 | Isodon eriocalyx and its bioactive component Eriocalyxin B enhance cytotoxic and apoptotic effects of gemcitabine in pancreatic cancer. Phytomedicine. 2018 May 15;44:56-64. doi: 10.1016/j.phymed.2018.03.055. | Click |
| 4 | Shikonin reverses cancer-associated fibroblast-induced gemcitabine resistance in pancreatic cancer cells by suppressing monocarboxylate transporter 4-mediated reverse Warburg effect. Phytomedicine. 2024 Jan;123:155214. doi: 10.1016/j.phymed.2023.155214. | Click |