
| Name | Leucine-rich repeat-containing protein 59 | ||
| UniProt ID | LRC59_HUMAN | ||
| Gene Name | LRRC59 | ||
| Gene ID | 55379 | ||
| Synonyms |
LRRC59, PRO1855, p34
|
||
| Sequence |
MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATILDLSCNKLTTLPSDFCG
LTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNKLVTLPVSFAQLKNLKWLDLKDNPL DPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRLEVEREAEKKREAKQRAK EAQERELRKREKAEEKERRRKEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRK HTRSWAVLKLLLLLLLFGVAGGLVACRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWV LQTDSQQ |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 1.A.25.3.7 | ||
| KEGG ID | hsa55379 | ||
| Pfam | PF00560; PF01080; PF12722; PF12794; PF12799; PF13855 | ||
| Pair Name | Resveratrol, Temozolomide | |||
| Phytochemical | Resveratrol | |||
| Drug | Temozolomide | |||
| Disease Info | [ICD-11: 2F7Z] | Glioma | Investigative | |
| Regulate Info | Down-regulation | Leucine-rich repeat-containing protein 59 | Expression | |
| Result | TMZ in combination with resveratrol remarkably increased reactive oxygen species (ROS) production, which serves as an upstream signal for AMP-activated protein kinase (AMPK) activation. Subsequently, activated AMPK inhibited mTOR signaling and downregulated antiapoptosis protein Bcl-2, which was contributed to the additive antiproliferation effects of combination treatment. In an orthotopic xenograft model of GBM, TMZ plus resveratrol treatment significantly reduced the volume of tumor, which was confirmed by decreased expression of Ki-67, a marker of proliferation index | |||