| Name | GTPase KRas | ||
| UniProt ID | RASK_HUMAN | ||
| Gene Name | KRAS | ||
| Gene ID | 3845 | ||
| Synonyms |
KRAS, 'C-K-RAS, C-K-RAS, CFC2, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, K-Ras, K-Ras_2, KI-RAS, KRAS1, KRAS2, NS, NS3, OES, RALD, RASK2, c-Ki-ras, c-Ki-ras2
|
||
| Sequence |
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3845 | ||
| TTD ID | T48598 | ||
| Pfam | PF00009; PF00025; PF00071; PF00735; PF01926; PF02421; PF03029; PF03193; PF08477 | ||
| Pair Name | Evodiamine, Doxorubicin | |||
| Phytochemical | Evodiamine | |||
| Drug | Doxorubicin | |||
| Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
| Regulate Info | Down-regulation | GTPase KRas | Expression | |
| Result | Our results indicated that EVO enhanced the apoptotic action of DOX by inhibiting the Ras/MEK/ERK cascade and the expression of IAPs without inhibiting the expression and activity of P-glycoprotein (P-gp). Taken together, our data indicate that EVO, a natural product, may be useful applied alone or in combination with DOX for the treatment of resistant breast cancer. | |||
| Pair Name | Luteolin, Gemcitabine | |||
| Phytochemical | Luteolin | |||
| Drug | Gemcitabine | |||
| Disease Info | [ICD-11: 2C10.0] | Pancreatic ductal adenocarcinoma | Investigative | |
| Regulate Info | Down-regulation | GTPase KRas | Expression | |
| Result | Luteolin + Gem promoted apoptotic cell death in pancreatic tumor cells in vivo through inhibition of the K-ras/GSK-3β/NF-κB signaling pathway, leading to a reduction in the Bcl-2/Bax ratio, release of cytochrome c, and activation of caspase 3. | |||
| Pair Name | Sulforaphene, Photodynamic therapy | |||
| Phytochemical | Sulforaphene | |||
| Drug | Photodynamic therapy | |||
| Disease Info | [ICD-11: 2D10.Z] | Thyroid cancer | Investigative | |
| Regulate Info | Down-regulation | GTPase KRas | Expression | |
| Result | Our work designates sulforaphene as a unique natural enhancer of efficacy with PDT against anaplastic thyroid cancer. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Evodiamine synergizes with doxorubicin in the treatment of chemoresistant human breast cancer without inhibiting P-glycoprotein. PLoS One. 2014 May 15;9(5):e97512. doi: 10.1371/journal.pone.0097512. | Click |
| 2 | Luteolin and Gemcitabine Protect Against Pancreatic Cancer in an Orthotopic Mouse Model. Pancreas. 2015 Jan;44(1):144-51. doi: 10.1097/MPA.0000000000000215. | Click |
| 3 | Sulforaphene Enhances The Efficacy of Photodynamic Therapy In Anaplastic Thyroid Cancer Through Ras/RAF/MEK/ERK Pathway Suppression. J Photochem Photobiol B. 2018 Feb;179:46-53. doi: 10.1016/j.jphotobiol.2017.12.013. | Click |
