| Name | Interferon regulatory factor 1 | ||
| UniProt ID | IRF1_HUMAN | ||
| Gene Name | IRF1 | ||
| Gene ID | 3659 | ||
| Synonyms |
IRF1, IMD117, IRF-1, MAR
|
||
| Sequence |
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQR KERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALT PALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKL LEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN MDATWLDSLLTPVRLPSIQAIPCAP |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3659 | ||
| TTD ID | T02723 | ||
| Pfam | PF00605 | ||
| Pair Name | Ginsenoside Rh2, Anti-PD-L1 antibody | |||
| Phytochemical | Ginsenoside Rh2 | |||
| Drug | Anti-PD-L1 antibody | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon regulatory factor 1 | Expression | |
| Result | These findings demonstrated that Rh2 potentiated the anti-cancer effect of PD-L1 blockade via promoting the T cells infiltration and activation, which shed a new light on the combination strategy to enhance anti-PD-L1 immunotherapy by using natural product Rh2. | |||
| Pair Name | Lycopene, Anti-PD-1 antibody | |||
| Phytochemical | Lycopene | |||
| Drug | Anti-PD-1 antibody | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Interferon regulatory factor 1 | Expression | |
| Result | lycopene promoted anti-PD-1 therapeutic efficiency of lung cancer by promoting IFNγ-expressing CD8+ cells infiltrated in tumor tissues and increasing IFNγ expression in tumor cells. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Ginsenoside Rh2 augmented anti-PD-L1 immunotherapy by reinvigorating CD8+ T cells via increasing intratumoral CXCL10. Pharmacol Res. 2023 Dec;198:106988. doi: 10.1016/j.phrs.2023.106988. | Click |
| 2 | Lycopene improves the efficiency of anti-PD-1 therapy via activating IFN signaling of lung cancer cells. Cancer Cell Int. 2019 Mar 21;19:68. doi: 10.1186/s12935-019-0789-y. | Click |
