| Name | Interleukin-2 | ||
| UniProt ID | IL2_HUMAN | ||
| Gene Name | IL2 | ||
| Gene ID | 3558 | ||
| Synonyms |
IL2, IL-2, TCGF, lymphokine
|
||
| Sequence |
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE TTFMCEYADETATIVEFLNRWITFCQSIISTLT |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.5.5.7; 3.A.1.5.25 | ||
| KEGG ID | hsa3558 | ||
| TTD ID | T61698 | ||
| Pfam | PF00715; PF07230; PF09686 | ||
| Pair Name | Isovitexin, Cisplatin | |||
| Phytochemical Name | Isovitexin | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C25] | Lung cancer | Investigative | |
| Regulate Info | Up-regulation | Interleukin-2 | Expression | |
| Result | IVT not only inhibited cell proliferation and glucose metabolism via downregulating the expression of PKM2 to enhance the antitumor activity of DDP against lung cancer cells, and improved DDP-induced immunotoxicity in mice. It also presented a novel strategy to enhance the anti-tumor effect of platinum-based chemotherapy against NSCLC. | |||
| Pair Name | Rosmarinic acid, Indoleamine 2,3-dioxygenase 1 | |||
| Phytochemical | Rosmarinic acid | |||
| Drug | Indoleamine 2,3-dioxygenase 1 | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Up-regulation | Interleukin-2 | Expression | |
| Result | The mechanism might be related to regulating immune response and immunocytokines, as well as alleviating immunosuppression induced by Tregs in the tumor immune microenvironment. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Isovitexin potentiated the antitumor activity of cisplatin by inhibiting the glucose metabolism of lung cancer cells and reduced cisplatin-induced immunotoxicity in mice. Int Immunopharmacol. 2021 May;94:107357. doi: 10.1016/j.intimp.2020.107357. | Click |
| 2 | Effects of gene silencing of indoleamine 2,3-dioxygenase 1 combined with rosmarinic acid on tumor immune microenvironment in H22 tumor-bearing mice. Int Immunopharmacol. 2023 Jun;119:110193. doi: 10.1016/j.intimp.2023.110193. | Click |
