| Name | Interleukin-19 | ||
| UniProt ID | IL19_HUMAN | ||
| Gene Name | IL19 | ||
| Gene ID | 29949 | ||
| Synonyms |
IL19, IL-10C, MDA1, NG.1, ZMDA1
|
||
| Sequence |
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTIL
STLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQ CQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa29949 | ||
| TTD ID | T44584 | ||
| Pfam | PF00726; PF13012 | ||
| Pair Name | Aloin, Doxorubicin | |||
| Phytochemical Name | Aloin | |||
| Anticancer drug Name | Doxorubicin | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Down-regulation | Interleukin-19 | Expression | |
| Result | Our results highlight the necessity to further investigate the chemopreventive effects of aloin against other chemotherapeutic agents. | |||
| No. | Title | Href |
|---|---|---|
| 1 | Aloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokinesAloin alleviates doxorubicin-induced cardiotoxicity in rats by abrogating oxidative stress and pro-inflammatory cytokines. Cancer Chemother Pharmacol. 2020 Sep;86(3):419-426. doi: 10.1007/s00280-020-04125-w. | Click |
