| Name | Heat shock protein beta-1 | ||
| UniProt ID | HSPB1_HUMAN | ||
| Gene Name | HSPB1 | ||
| Gene ID | 3315 | ||
| Synonyms |
HSPB1, CMT2F, HEL-S-102, HMN2B, HMND3, HS.76067, HSP27, HSP28, Hsp25, SRP27
|
||
| Sequence |
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa3315 | ||
| TTD ID | T11253 | ||
| Pfam | PF00011; PF07873 | ||
| Pair Name | Curcumin, Temozolomide | |||
| Phytochemical Name | Curcumin | |||
| Anticancer drug Name | Temozolomide | |||
| Disease Info | [ICD-11: 2A00] | Glioblastoma multiforme | Investigative | |
| Regulate Info | Down-regulation | Heat shock protein beta-1 | Expression | |
| Result | We showed for the first time that exosomes released from drug-treated U87 cells could be a new therapeutic approach in glioblastoma, and could reduce the side effects produced by drugs alone. This concept needs to be further examined in animal models before clinical trials could be considered. | |||
