Name | High mobility group protein B1 | ||
UniProt ID | HMGB1_HUMAN | ||
Gene Name | HMGB1 | ||
Gene ID | 3146 | ||
Synonyms |
HMGB1, HMG-1, HMG1, HMG3, SBP-1
|
||
Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa3146 | ||
TTD ID | T63595 | ||
Pfam | PF00505; PF04147; PF06524; PF09011; PF14887 |
Pair Name | Camptothecin, Camptosar | |||
Phytochemical | Camptothecin | |||
Drug | Camptosar | |||
Disease Info | [ICD-11: 2C60] | Breast cancer | Investigative | |
Regulate Info | Up-regulation | High mobility group protein B1 | Expression | |
Result | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy |
Pair Name | Lycorine, Bortezomib | |||
Phytochemical | Lycorine | |||
Drug | Bortezomib | |||
Disease Info | [ICD-11: 2A83.1] | Multiple myeloma | Investigative | |
Regulate Info | Down-regulation | High mobility group protein B1 | Expression | |
Result | We observed higher HMGB1 expression in bortezomib resistant cells and the combination of bortezomib plus lycorine was highly efficient in vitro and in vivo myeloma models as well as in re-sensitizing resistant cells to bortezomib. These observations indicate lycorine as an effective autophagy inhibitor and reveal that lycorine alone or in combination with bortezomib is a potential therapeutic strategy. |
Pair Name | Morin Hydrate, Cisplatin | |||
Phytochemical | Morin Hydrate | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | High mobility group protein B1 | Expression | |
Result | Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model. |
Pair Name | Shikonin, Anti-mouse PD-1 | |||
Phytochemical | Shikonin | |||
Drug | Anti-mouse PD-1 | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | High mobility group protein B1 | Expression | |
Result | Our study elucidated the potential role of 'Shikonin-PKM2-ROS-Hsp70' axis in the promotion of efficacy of PD-1 blockade in CRC treatments, providing a potential strategy and targets for improving the efficacy of PD-1 blockade in colorectal cancer. |
Pair Name | Morin Hydrate, Cisplatin | |||
Phytochemical | Morin Hydrate | |||
Drug | Cisplatin | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | High mobility group protein B1 | Expression | |
Result | The combination of Morin hydrate with cisplatin may be a promising therapeutic strategy to enhance the efficacy of conventional chemotherapeutic drugs. |
No. | Title | Href |
---|---|---|
1 | Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy. Mol Pharm. 2022 Dec 5;19(12):4665-4674. doi: 10.1021/acs.molpharmaceut.2c00701. | Click |
2 | Lycorine Downregulates HMGB1 to Inhibit Autophagy and Enhances Bortezomib Activity in Multiple Myeloma. Theranostics. 2016 Sep 24;6(12):2209-2224. doi: 10.7150/thno.15584. | Click |
3 | Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. | Click |
4 | Shikonin improves the effectiveness of PD-1 blockade in colorectal cancer by enhancing immunogenicity via Hsp70 upregulation. Mol Biol Rep. 2024 Jan 6;51(1):86. doi: 10.1007/s11033-023-09056-2. | Click |
5 | Morin Hydrate Reverses Cisplatin Resistance by Impairing PARP1/HMGB1-Dependent Autophagy in Hepatocellular Carcinoma. Cancers (Basel). 2019 Jul 15;11(7):986. doi: 10.3390/cancers11070986. | Click |