TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name High mobility group protein B1
UniProt ID HMGB1_HUMAN
Gene Name HMGB1
Gene ID 3146
Synonyms
HMGB1, HMG-1, HMG1, HMG3, SBP-1
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
Pathway Map MAP LINK
KEGG ID hsa3146
TTD ID T63595
Pfam PF00505; PF04147; PF06524; PF09011; PF14887
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 3
Pair Name Camptothecin, Camptosar
Phytochemical Camptothecin
Drug Camptosar
Disease Info [ICD-11: 2C60] Breast cancer Investigative
Regulate Info Up-regulation High mobility group protein B1 Expression
Result Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy
Combination Pair ID: 23
Pair Name Lycorine, Bortezomib
Phytochemical Lycorine
Drug Bortezomib
Disease Info [ICD-11: 2A83] Multiple myeloma Investigative
Regulate Info Down-regulation High mobility group protein B1 Expression
Result We observed higher HMGB1 expression in bortezomib resistant cells and the combination of bortezomib plus lycorine was highly efficient in vitro and in vivo myeloma models as well as in re-sensitizing resistant cells to bortezomib. These observations indicate lycorine as an effective autophagy inhibitor and reveal that lycorine alone or in combination with bortezomib is a potential therapeutic strategy.
Combination Pair ID: 119
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation High mobility group protein B1 Expression
Result Our findings indicate that CP-Mh in combination served as a prominent regulator of autophagy and significant inducer of apoptosis that maintains a homeostatic balance towards HepG2 cells and the subcutaneous tumor model.
Combination Pair ID: 1036
Pair Name Shikonin, Anti-mouse PD-1
Phytochemical Shikonin
Drug Anti-mouse PD-1
Disease Info [ICD-11: 2B91] Colorectal cancer Investigative
Regulate Info Down-regulation High mobility group protein B1 Expression
Result Our study elucidated the potential role of 'Shikonin-PKM2-ROS-Hsp70' axis in the promotion of efficacy of PD-1 blockade in CRC treatments, providing a potential strategy and targets for improving the efficacy of PD-1 blockade in colorectal cancer.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 120
Pair Name Morin Hydrate, Cisplatin
Phytochemical Morin Hydrate
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation High mobility group protein B1 Expression
Result The combination of Morin hydrate with cisplatin may be a promising therapeutic strategy to enhance the efficacy of conventional chemotherapeutic drugs.
03. Reference
No. Title Href
1 Camptothesome Potentiates PD-L1 Immune Checkpoint Blockade for Improved Metastatic Triple-Negative Breast Cancer Immunochemotherapy. Mol Pharm. 2022 Dec 5;19(12):4665-4674. doi: 10.1021/acs.molpharmaceut.2c00701. Click
2 Lycorine Downregulates HMGB1 to Inhibit Autophagy and Enhances Bortezomib Activity in Multiple Myeloma. Theranostics. 2016 Sep 24;6(12):2209-2224. doi: 10.7150/thno.15584. Click
3 Morin Hydrate Sensitizes Hepatoma Cells and Xenograft Tumor towards Cisplatin by Downregulating PARP-1-HMGB1 Mediated Autophagy. Int J Mol Sci. 2020 Nov 4;21(21):8253. doi: 10.3390/ijms21218253. Click
4 Shikonin improves the effectiveness of PD-1 blockade in colorectal cancer by enhancing immunogenicity via Hsp70 upregulation. Mol Biol Rep. 2024 Jan 6;51(1):86. doi: 10.1007/s11033-023-09056-2. Click
5 Morin Hydrate Reverses Cisplatin Resistance by Impairing PARP1/HMGB1-Dependent Autophagy in Hepatocellular Carcinoma. Cancers (Basel). 2019 Jul 15;11(7):986. doi: 10.3390/cancers11070986. Click
It has been 58484 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP