| Name | Histone H3.1 | ||
| UniProt ID | H31_HUMAN | ||
| Gene Name | H3C1 | ||
| Gene ID | 8350 | ||
| Synonyms |
H3C1, H3/A, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, HIST1H3A
|
||
| Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa8350 | ||
| Pfam | PF00125; PF00808; PF02291; PF15511; PF15630; PF15715; PF21150 | ||
| Pair Name | Curcumin, Olaparib | |||
| Phytochemical | Curcumin | |||
| Drug | Olaparib | |||
| Disease Info | [ICD-11: 2B66.Z] | Oral cancer | Investigative | |
| Regulate Info | Down-regulation | Histone H3.1 | Expression | |
| Result | The present study reveals that Cur + Ola treatment increased oral cancer cell death not only through catalytic inhibition of PARP-1 but also predominantly through PARP-1 trapping and indirect inhibition of chromatin remodeling. | |||
| Pair Name | Tanshinone IIA, Aurora kinase inhibitor | |||
| Phytochemical | Tanshinone IIA | |||
| Drug | Aurora kinase inhibitor | |||
| Disease Info | [ICD-11: 2B66.0] | Oral squamous cell carcinoma | Investigative | |
| Regulate Info | Down-regulation | Histone H3.1 | Phosphorylation | |
| Result | Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance | |||
| No. | Title | Href |
|---|---|---|
| 1 | Olaparib enhances curcumin-mediated apoptosis in oral cancer cells by inducing PARP trapping through modulation of BER and chromatin assembly. DNA Repair (Amst). 2021 Sep;105:103157. doi: 10.1016/j.dnarep.2021.103157. | Click |
| 2 | Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance. Cell Death Dis. 2021 Feb 4;12(2):152. doi: 10.1038/s41419-021-03434-z. | Click |
