TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Histone H3.1
UniProt ID H31_HUMAN
Gene Name H3C1
Gene ID 8350
Synonyms
H3C1, H3/A, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, HIST1H3A
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Pathway Map MAP LINK
KEGG ID hsa8350
Pfam PF00125; PF00808; PF02291; PF15511; PF15630; PF15715; PF21150
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Enhancing Drug Efficacy
Hide/Show
Combination Pair ID: 297
Pair Name Tanshinone IIA, Aurora kinase inhibitor
Phytochemical Tanshinone IIA
Drug Aurora kinase inhibitor
Disease Info [ICD-11: 2B66.0] Oral squamous cell carcinoma Investigative
Regulate Info Down-regulation Histone H3.1 Phosphorylation
Result Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance
Combination Pair ID: 392
Pair Name Curcumin, Olaparib
Phytochemical Curcumin
Drug Olaparib
Disease Info [ICD-11: 2B66.Z] Oral cancer Investigative
Regulate Info Down-regulation Histone H3.1 Expression
Result The present study reveals that Cur + Ola treatment increased oral cancer cell death not only through catalytic inhibition of PARP-1 but also predominantly through PARP-1 trapping and indirect inhibition of chromatin remodeling.
03. Reference
No. Title Href
1 Targeting Aurora B kinase with Tanshinone IIA suppresses tumor growth and overcomes radioresistance. Cell Death Dis. 2021 Feb 4;12(2):152. doi: 10.1038/s41419-021-03434-z. Click
2 Olaparib enhances curcumin-mediated apoptosis in oral cancer cells by inducing PARP trapping through modulation of BER and chromatin assembly. DNA Repair (Amst). 2021 Sep;105:103157. doi: 10.1016/j.dnarep.2021.103157. Click
It has been 512431 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP