| Name | Glutathione S-transferase kappa 1 | ||
| UniProt ID | GSTK1_HUMAN | ||
| Gene Name | GSTK1 | ||
| Gene ID | 373156 | ||
| Synonyms |
GSTK1, GST, GST_13-13, GST13, GST13-13, GSTK1-1, hGSTK1
|
||
| Sequence |
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa373156 | ||
| Pfam | PF00563; PF01323 | ||
| Pair Name | Chrysin, Paclitaxel | |||
| Phytochemical Name | Chrysin | |||
| Anticancer drug Name | Paclitaxel | |||
| Disease Info | [ICD-11: 2A00-2F9Z] | Solid tumour or cancer | Investigative | |
| Regulate Info | Down-regulation | Glutathione S-transferase kappa 1 | Expression | |
| Result | CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity. | |||
| Pair Name | Ursolic acid, Cisplatin | |||
| Phytochemical | Ursolic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Glutathione S-transferase kappa 1 | Expression | |
| Result | The results confirmed the sensibilization of UA on HepG2/DDP cells to cisplatin, which was possibly mediated via the Nrf2/antioxidant response element pathway. | |||
| Pair Name | Ursolic acid, Cisplatin | |||
| Phytochemical | Ursolic acid | |||
| Drug | Cisplatin | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Glutathione S-transferase kappa 1 | Expression | |
| Result | Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway | |||
| No. | Title | Href |
|---|---|---|
| 1 | Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. | Click |
| 2 | Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway. Drug Des Devel Ther. 2016 Oct 25;10:3471-3481. doi: 10.2147/DDDT.S110505. | Click |
| 3 | Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway. Drug Des Devel Ther. 2016 Oct 25;10:3471-3481. doi: 10.2147/DDDT.S110505. | Click |
