TOP
Nav Bar
  1. General Info
  2. Effects Info
  3. Reference
Molecular Details
01. General Information
Name Glutathione S-transferase kappa 1
UniProt ID GSTK1_HUMAN
Gene Name GSTK1
Gene ID 373156
Synonyms
GSTK1, GST, GST_13-13, GST13, GST13-13, GSTK1-1, hGSTK1
Sequence
MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLP
RKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRE
LWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGA
FGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
Pathway Map MAP LINK
KEGG ID hsa373156
Pfam PF00563; PF01323
02. Combinatorial Therapeutic Effect(s)
Synergistic Effect
Hide/Show
Decreasing Drug Toxicity
Hide/Show
Combination Pair ID: 997
Pair Name Chrysin, Paclitaxel
Phytochemical Name Chrysin
Anticancer drug Name Paclitaxel
Disease Info [ICD-11: 2A00-2F9Z] Solid tumour or cancer Investigative
Regulate Info Down-regulation Glutathione S-transferase kappa 1 Expression
Result CR exhibited the ability to reduce oxidative DNA damage, exert anti-apoptotic and anti-inflammatory properties, and mitigate the toxic effects of Pax-induced hepatorenal toxicity.
Reversing Drug Resistance
Hide/Show
Combination Pair ID: 682
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Glutathione S-transferase kappa 1 Expression
Result The results confirmed the sensibilization of UA on HepG2/DDP cells to cisplatin, which was possibly mediated via the Nrf2/antioxidant response element pathway.
Combination Pair ID: 682
Pair Name Ursolic acid, Cisplatin
Phytochemical Ursolic acid
Drug Cisplatin
Disease Info [ICD-11: 2C12] Hepatocellular carcinoma Investigative
Regulate Info Down-regulation Glutathione S-transferase kappa 1 Expression
Result Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway
03. Reference
No. Title Href
1 Chrysin attenuates paclitaxel-induced hepatorenal toxicity in rats by suppressing oxidative damage, inflammation, and apoptosis. Life Sci. 2023 Nov 1;332:122096. doi: 10.1016/j.lfs.2023.122096. Click
2 Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway. Drug Des Devel Ther. 2016 Oct 25;10:3471-3481. doi: 10.2147/DDDT.S110505. Click
3 Ursolic acid sensitizes cisplatin-resistant HepG2/DDP cells to cisplatin via inhibiting Nrf2/ARE pathway. Drug Des Devel Ther. 2016 Oct 25;10:3471-3481. doi: 10.2147/DDDT.S110505. Click
It has been 58495 visits since 2024.08
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang
TOP