Name | Glutathione S-transferase A1 | ||
UniProt ID | GSTA1_HUMAN | ||
Gene Name | GSTA1 | ||
Gene ID | 2938 | ||
Synonyms |
GSTA1, GST-epsilon, GST2, GSTA1-1, GTH1
|
||
Sequence |
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF |
||
Pathway Map | MAP LINK | ||
KEGG ID | hsa2938 | ||
TTD ID | T17221 | ||
Pfam | PF00043; PF02798; PF13409; PF13417; PF14497 |
Pair Name | Luteolin, Oxaliplatin | |||
Phytochemical | Luteolin | |||
Drug | Oxaliplatin | |||
Disease Info | [ICD-11: 2B90.Z] | Colon cancer | Investigative | |
Regulate Info | Down-regulation | Glutathione S-transferase A1 | Expression | |
Result | Adaptive activation of Nrf2 may contribute to the development of acquired drug-resistance and luteolin could restore sensitivity of oxaliplatin-resistant cell lines to chemotherapeutic drugs. Inhibition of the Nrf2 pathway may be the mechanism for this restored therapeutic response. |