| Name | Glutathione S-transferase A1 | ||
| UniProt ID | GSTA1_HUMAN | ||
| Gene Name | GSTA1 | ||
| Gene ID | 2938 | ||
| Synonyms |
GSTA1, GST-epsilon, GST2, GSTA1-1, GTH1
|
||
| Sequence |
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAK LALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL LKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF |
||
| Pathway Map | MAP LINK | ||
| KEGG ID | hsa2938 | ||
| TTD ID | T17221 | ||
| Pfam | PF00043; PF02798; PF13409; PF13417; PF14497 | ||
| Pair Name | Luteolin, Oxaliplatin | |||
| Phytochemical | Luteolin | |||
| Drug | Oxaliplatin | |||
| Disease Info | [ICD-11: 2B90] | Colon cancer | Investigative | |
| Regulate Info | Down-regulation | Glutathione S-transferase A1 | Expression | |
| Result | Adaptive activation of Nrf2 may contribute to the development of acquired drug-resistance and luteolin could restore sensitivity of oxaliplatin-resistant cell lines to chemotherapeutic drugs. Inhibition of the Nrf2 pathway may be the mechanism for this restored therapeutic response. | |||
