Name | Ferritin heavy chain | ||
UniProt ID | FRIH_HUMAN | ||
Gene Name | FTH1 | ||
Gene ID | 2495 | ||
Synonyms |
FTH1, FHC, FTH, FTHL6, HFE5, NBIA9, PIG15, PLIF
|
||
Sequence |
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD NES |
||
Pathway Map | MAP LINK | ||
T.C. Number | 2.A.108.1.4 | ||
KEGG ID | hsa2495 | ||
TTD ID | T89873 | ||
Pfam | PF00110; PF00210; PF02915 |
Pair Name | Dihydroartemisinin, Cisplatin | |||
Phytochemical Name | Dihydroartemisinin | |||
Anticancer drug Name | Cisplatin | |||
Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
Regulate Info | Up-regulation | Ferritin heavy chain | Expression | |
Result | DHA exhibits synergistic therapeutic efficacy with cisplatin to induce ferroptosis in pancreatic ductal adenocarcinoma via modulation of iron metabolism |
Pair Name | Tiliroside, Sorafenib | |||
Phytochemical | Tiliroside | |||
Drug | Sorafenib | |||
Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
Result | Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis. |
Pair Name | All-trans retinoic acid, Decitabine | |||
Phytochemical | All-trans-retinoic acid | |||
Drug | Decitabine | |||
Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
Result | These results demonstrate that combining DAC and ATRA has potential for the clinical treatment of HR-MDS/AML and merits further exploration. |
Pair Name | Beta-Elemene, Cetuximab | |||
Phytochemical | Beta-Elemene | |||
Drug | Cetuximab | |||
Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. |
No. | Title | Href |
---|---|---|
1 | DHA exhibits synergistic therapeutic efficacy with cisplatin to induce ferroptosis in pancreatic ductal adenocarcinoma via modulation of iron metabolism. Cell Death Dis. 2021 Jul 15;12(7):705. doi: 10.1038/s41419-021-03996-y. | Click |
2 | Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. | Click |
3 | All-trans retinoic acid enhances the cytotoxic effect of decitabine on myelodysplastic syndromes and acute myeloid leukaemia by activating the RARα-Nrf2 complex. Br J Cancer. 2023 Feb;128(4):691-701. doi: 10.1038/s41416-022-02074-0. | Click |
4 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |