
| Name | Ferritin heavy chain | ||
| UniProt ID | FRIH_HUMAN | ||
| Gene Name | FTH1 | ||
| Gene ID | 2495 | ||
| Synonyms |
FTH1, FHC, FTH, FTHL6, HFE5, NBIA9, PIG15, PLIF
|
||
| Sequence |
MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQS
HEEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHK LATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSD NES |
||
| Pathway Map | MAP LINK | ||
| T.C. Number | 2.A.108.1.4 | ||
| KEGG ID | hsa2495 | ||
| TTD ID | T89873 | ||
| Pfam | PF00110; PF00210; PF02915 | ||
| Pair Name | Dihydroartemisinin, Cisplatin | |||
| Phytochemical Name | Dihydroartemisinin | |||
| Anticancer drug Name | Cisplatin | |||
| Disease Info | [ICD-11: 2C10.Z] | Pancreatic cancer | Investigative | |
| Regulate Info | Up-regulation | Ferritin heavy chain | Expression | |
| Result | DHA exhibits synergistic therapeutic efficacy with cisplatin to induce ferroptosis in pancreatic ductal adenocarcinoma via modulation of iron metabolism | |||
| Pair Name | Tiliroside, Sorafenib | |||
| Phytochemical | Tiliroside | |||
| Drug | Sorafenib | |||
| Disease Info | [ICD-11: 2C12] | Hepatocellular carcinoma | Investigative | |
| Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
| Result | Our findings imply that tiliroside is a potent TBK1 inhibitor and a candidate natural anti-cancer product that could function as a sensitizer of sorafenib in HCC treatment by targeting TBK1 to induce ferroptosis. | |||
| Pair Name | All-trans retinoic acid, Decitabine | |||
| Phytochemical | All-trans-retinoic acid | |||
| Drug | Decitabine | |||
| Disease Info | [ICD-11: 2A60.Z] | Acute myeloid leukemia | Investigative | |
| Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
| Result | These results demonstrate that combining DAC and ATRA has potential for the clinical treatment of HR-MDS/AML and merits further exploration. | |||
| Pair Name | Beta-Elemene, Cetuximab | |||
| Phytochemical | Beta-Elemene | |||
| Drug | Cetuximab | |||
| Disease Info | [ICD-11: 2B91.Z] | Colorectal cancer | Investigative | |
| Regulate Info | Down-regulation | Ferritin heavy chain | Expression | |
| Result | natural product β-elemene is a new ferroptosis inducer and combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant CRC cells by inducing ferroptosis and inhibiting EMT, which will hopefully provide a prospective strategy for CRC patients with RAS mutations. | |||
| No. | Title | Href |
|---|---|---|
| 1 | DHA exhibits synergistic therapeutic efficacy with cisplatin to induce ferroptosis in pancreatic ductal adenocarcinoma via modulation of iron metabolism. Cell Death Dis. 2021 Jul 15;12(7):705. doi: 10.1038/s41419-021-03996-y. | Click |
| 2 | Tiliroside targets TBK1 to induce ferroptosis and sensitize hepatocellular carcinoma to sorafenib. Phytomedicine. 2023 Mar;111:154668. doi: 10.1016/j.phymed.2023.154668. | Click |
| 3 | All-trans retinoic acid enhances the cytotoxic effect of decitabine on myelodysplastic syndromes and acute myeloid leukaemia by activating the RARα-Nrf2 complex. Br J Cancer. 2023 Feb;128(4):691-701. doi: 10.1038/s41416-022-02074-0. | Click |
| 4 | Combinative treatment of β-elemene and cetuximab is sensitive to KRAS mutant colorectal cancer cells by inducing ferroptosis and inhibiting epithelial-mesenchymal transformation. Theranostics. 2020;10(11):5107-5119. Published 2020 Apr 6. doi:10.7150/thno.44705 | Click |