InterPAD - DETAILS

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT
ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK
VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV
QQARDLQNRSGAMSPMSWNSDASTSEAS

No.	Title	Href
1	Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095.	`Click`
2	EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109.	`Click`
3	Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003.	`Click`
4	β-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385. doi: 10.1002/cbin.11023.	`Click`

No.

Title

Href

Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation. Biomed Pharmacother. 2017 Sep;93:948-960. doi: 10.1016/j.biopha.2017.06.095.

Click

EGCG sensitizes human nasopharyngeal carcinoma cells to TRAIL-mediated apoptosis by activation NF-κB. Neoplasma. 2017;64(1):74-80. doi: 10.4149/neo_2017_109.

Click

Irigenin sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells. Biochem Biophys Res Commun. 2018 Feb 12;496(3):998-1005. doi: 10.1016/j.bbrc.2018.01.003.

Click

β-elemene increases the sensitivity of gastric cancer cells to TRAIL by promoting the formation of DISC in lipid rafts. Cell Biol Int. 2018 Sep;42(10):1377-1385. doi: 10.1002/cbin.11023.

Click

Name	FAS-associated death domain protein
UniProt ID	FADD_HUMAN
Gene Name	FADD
Gene ID	8772
Synonyms	FADD, GIG3, IMD90, MORT1
Sequence	MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHT ELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLK VSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEV QQARDLQNRSGAMSPMSWNSDASTSEAS
Pathway Map	`MAP LINK`
T.C. Number	4.C.1.1.4
KEGG ID	hsa8772
Pfam	PF00531; PF01335

Pair Name	Liquiritin, TNF-related apoptosis inducing ligand
Phytochemical	Liquiritin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B72.Z]	Gastric cancer	Investigative
Regulate Info	Up-regulation	FAS-associated death domain protein	Expression
Result	Combining TRAIL and liquiritin exerts synergistic effects against human gastric cancer cells and xenograft in nude mice through potentiating apoptosis and ROS generation

Pair Name	Epigallocatechin gallate, TNF-related apoptosis inducing ligand
Phytochemical	Epigallocatechin gallate
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B6B]	Nasopharyngeal carcinoma	Investigative
Regulate Info	Down-regulation	FAS-associated death domain protein	Expression
Result	EGCG sensitizes NPC cells to TRAIL-mediated apoptosis via modulation of extrinsic and intrinsic apoptotic pathways and inhibition of NF-κB activation.

Pair Name	Irigenin, TNF-related apoptosis inducing ligand
Phytochemical	Irigenin
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2B72.Z]	Gastric cancer	Investigative
Regulate Info	Up-regulation	FAS-associated death domain protein	Expression
Result	Our present study gave new insights into the effects of Iri on potentiating TRAIL-sensitivity, and suggested that Iri could be a potential candidate for sensitizer of TRAIL-resistant cancer cell treatment.

Pair Name	Beta-Elemene, TNF-related apoptosis inducing ligand
Phytochemical	Beta-Elemene
Drug	TNF-related apoptosis inducing ligand
Disease Info	[ICD-11: 2C25.Z]	Lung cancer	Investigative
Regulate Info	Up-regulation	FAS-associated death domain protein	Expression
Result	Our results suggest that β-elemene increases the sensitivity of gastric cancer cells to TRAIL partially by promoting the formation of DISC in lipid rafts.